Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023559 [exp] 155 / 8e-46 ND / Lus10040445 [exp] 144 / 1e-43 ND / Lus10040440 [exp] 79 / 4e-20 ND / Lus10022836 [exp] 54 / 2e-09 ND / Lus10029057 [exp] 48 / 3e-07 ND / Lus10024121 [exp] 40 / 0.0001 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G156500 [exp] 77 / 1e-17 ND / Potri.001G388900 [exp] 62 / 4e-12 ND / Potri.011G108300 [exp] 58 / 1e-10 ND / Potri.001G388300 [exp] 56 / 4e-10 ND / Potri.001G388200 [exp] 56 / 6e-10 ND / Potri.001G388600 [exp] 55 / 7e-10 ND / Potri.001G388801 [exp] 55 / 8e-10 ND / Potri.001G388100 [exp] 55 / 8e-10 ND / Potri.001G387900 [exp] 55 / 9e-10 ND / Potri.011G108200 [exp] 55 / 1e-09 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0122 [flax] [poplar] UTRA PF12143 [flax] [poplar] PPO1_KFDV Protein of unknown function (DUF_B2219)
Representative CDS sequence Show only first row Show all	>Lus10023556 pacid=23160494 polypeptide=Lus10023556 locus=Lus10023556.g ID=Lus10023556.BGIv1.0 annot-version=v1.0 ATGTGGATGAATGTCATACCGAAACCTTCGATCGCGCTTAGGTTAACCAAACGCGAACTCAGGAGGGAGAAGGAACAAGATAGTAATATGTTGGAAATGC CGTCCCAGGCCCAGCATCTCCAACACATTGGTCATGTCCTCGACTCTCGAGTAACAATTCGCGTGGTTCGGCCGAGGGCGGTCAGGACCCGAAAGGAGAA AGACCAATTTGAAGAGATATTGGTGGTGGAAGGGATTGTCGTGAAGGCCGAAGAGTTTGTGAACTTTGACGTGTACATCAACGTGGTGAACAGGACGATA ATGAGCGCCAAGTACCGGGAGTTTGCAGGGACGTTCACCGATATCCCGATGGGGGTATAG
AA sequence Show only first row Show all	>Lus10023556 pacid=23160494 polypeptide=Lus10023556 locus=Lus10023556.g ID=Lus10023556.BGIv1.0 annot-version=v1.0 MWMNVIPKPSIALRLTKRELRREKEQDSNMLEMPSQAQHLQHIGHVLDSRVTIRVVRPRAVRTRKEKDQFEEILVVEGIVVKAEEFVNFDVYINVVNRTI MSAKYREFAGTFTDIPMGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023556 [exp]	0	1
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Lus10011998 [exp]	6.6	0.8918
AT3G56570			SET domain-containing protein ...		Lus10029539 [exp]	9.6	0.8887
					Lus10032472 [exp]	11.5	0.8864
AT5G15430			Plant calmodulin-binding prote...		Lus10015733 [exp]	11.8	0.8833
AT1G15910		FDM1	factor of DNA methylation 1, X...		Lus10040287 [exp]	13.6	0.8860
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10002511 [exp]	15.4	0.7994
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10002301 [exp]	17.8	0.7821
AT5G27870			Plant invertase/pectin methyle...		Lus10037489 [exp]	18.3	0.8750
AT1G78570		ATRHM1, RHM1, R...	REPRESSOR OF LRX1 1, ARABIDOPS...		Lus10020776 [exp]	21.0	0.7647
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036819 [exp]	21.4	0.8769

Compare expression of checked genes

Lus10023556 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.