Lus10023578 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G28780 84 / 7e-20 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G55050 71 / 3e-15 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT2G23540 70 / 7e-15 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G37690 69 / 2e-14 SGNH hydrolase-type esterase superfamily protein (.1)
AT1G29670 69 / 2e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT5G33370 68 / 3e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
AT1G71250 67 / 8e-14 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT1G74460 67 / 1e-13 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
AT3G04290 66 / 3e-13 ATLTL1, LTL1 Li-tolerant lipase 1 (.1)
AT5G18430 64 / 9e-13 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026647 243 / 4e-81 AT5G55050 159 / 4e-45 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10017903 210 / 4e-70 AT4G28780 85 / 3e-19 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10004668 191 / 5e-61 AT5G55050 184 / 6e-55 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10012135 159 / 1e-49 AT1G29670 84 / 8e-19 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10011312 159 / 1e-49 AT1G29670 88 / 7e-20 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10026644 139 / 6e-41 AT4G28780 113 / 2e-28 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10026646 110 / 2e-29 AT1G29670 72 / 1e-13 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10030410 101 / 3e-26 AT5G55050 147 / 1e-40 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Lus10026645 97 / 8e-25 AT5G55050 154 / 2e-43 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G130100 77 / 2e-17 AT5G37690 526 / 0.0 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.012G068700 75 / 2e-16 AT1G74460 549 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.004G086700 74 / 3e-16 AT5G37690 527 / 0.0 SGNH hydrolase-type esterase superfamily protein (.1)
Potri.019G024600 74 / 4e-16 AT5G33370 568 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
Potri.004G180400 72 / 1e-15 AT4G28780 200 / 4e-61 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.013G051000 72 / 2e-15 AT3G04290 543 / 0.0 Li-tolerant lipase 1 (.1)
Potri.002G253400 71 / 5e-15 AT4G28780 558 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.005G104900 69 / 1e-14 AT5G55050 209 / 7e-64 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Potri.019G024700 69 / 1e-14 AT5G33370 549 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
Potri.019G024400 69 / 2e-14 AT3G04290 538 / 0.0 Li-tolerant lipase 1 (.1)
PFAM info
Representative CDS sequence
>Lus10023578 pacid=23160502 polypeptide=Lus10023578 locus=Lus10023578.g ID=Lus10023578.BGIv1.0 annot-version=v1.0
ATGTTCGGGGTCGTAGGACCGCAACAAATCGGGTGCAGTCCAATTGCTCGAGCCCGTAGCCCAACCGGGCGCTGCCGTACCAGAGCAAATTCGATTGCGG
AGGCTATCCCTTCCCGATTGGCCGTAGCTATGGGCATGCTCAGAGTTACAAATCGAGATATTATTTATTCGGTCGCGAATACTTATAACATAAACAGCGA
CCTCACCAACAGTCCAACACTATACGGTTTAAGGAACGTTACGGGTGCATGTTGTGGGAACGGAACGACGCTATGCGTTCCGAATTCTACTGTGTGCGAG
GACCGCGATAGGTACTTGTATTGGAATCCGGCTCAACTAACCCAAAGCGGGTCGAGATTGGTTGTTGAAGCATTTTTCAGTGAAAATTTCGAGATACACG
GACCCTATAAGCTTTGCACAGTTGATTAA
AA sequence
>Lus10023578 pacid=23160502 polypeptide=Lus10023578 locus=Lus10023578.g ID=Lus10023578.BGIv1.0 annot-version=v1.0
MFGVVGPQQIGCSPIARARSPTGRCRTRANSIAEAIPSRLAVAMGMLRVTNRDIIYSVANTYNINSDLTNSPTLYGLRNVTGACCGNGTTLCVPNSTVCE
DRDRYLYWNPAQLTQSGSRLVVEAFFSENFEIHGPYKLCTVD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G28780 GDSL-like Lipase/Acylhydrolase... Lus10023578 0 1
AT5G12460 Protein of unknown function (D... Lus10003179 2.8 1.0000
AT1G18720 Protein of unknown function (D... Lus10001647 3.2 1.0000
Lus10003763 3.5 1.0000
Lus10006079 5.3 1.0000
Lus10010414 6.3 1.0000
AT2G22620 Rhamnogalacturonate lyase fami... Lus10010628 6.9 1.0000
Lus10010663 7.0 1.0000
Lus10034359 7.7 1.0000
AT1G15780 unknown protein Lus10023978 8.0 1.0000
AT2G41970 Protein kinase superfamily pro... Lus10016247 8.7 1.0000

Lus10023578 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.