Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18820 330 / 3e-117 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 321 / 3e-113 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT1G52280 304 / 1e-106 AtRABG3d RAB GTPase homolog G3D (.1) AT3G16100 301 / 2e-105 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT4G09720 269 / 8e-93 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 265 / 2e-91 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT2G21880 244 / 6e-83 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT5G39620 190 / 1e-61 AtRABG1 RAB GTPase homolog G1 (.1) AT5G59840 112 / 6e-31 Ras-related small GTP-binding family protein (.1) AT3G53610 110 / 2e-30 ATRAB8, AtRab8B, AtRABE1a RAB GTPase homolog 8 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042328 [exp] 349 / 2e-124 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10040468 [exp] 345 / 5e-123 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10035872 [exp] 314 / 1e-110 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10028719 [exp] 282 / 6e-98 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 264 / 5e-91 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10025790 [exp] 150 / 2e-46 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10005443 [exp] 112 / 5e-31 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10005890 [exp] 107 / 3e-29 AT3G46060 396 / 2e-142 RAB GTPase homolog 8A (.1.2.3) Lus10001026 [exp] 107 / 5e-29 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G115000 [exp] 341 / 3e-121 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.004G153400 [exp] 339 / 2e-120 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.003G053400 [exp] 296 / 2e-103 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 291 / 1e-101 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.002G062400 [exp] 280 / 3e-97 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 273 / 2e-94 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 251 / 1e-85 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.007G079700 [exp] 214 / 1e-71 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.010G208900 [exp] 112 / 5e-31 AT3G46060 349 / 5e-124 RAB GTPase homolog 8A (.1.2.3) Potri.001G080400 [exp] 111 / 8e-31 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10023582 pacid=23160639 polypeptide=Lus10023582 locus=Lus10023582.g ID=Lus10023582.BGIv1.0 annot-version=v1.0 ATGCCTTCCCGTCGAAGAACTCTGCTGAAGGTCATCATACTCGGTGACAGCGGATATGTAAACAAGAAGTTCAGCAATCAGTACAAGGCAACAATTGGTG CCGATTTCTTGACAAAGGAAGTGCAGTTTGAAGATAGGCTCTTCACTCTACAGCTTAACGTCCAATGCATGTTGCTTTGGCAGATCTGGGATACTGCTGG ACAGGAAAGATTCCAAAGCCTTGGTGTTGCCTTCTATCGTGGCGCTGATTGCTGTGTTCTAGTCTATGATGTTAACTCGATGAAATCGTTTGACAATCTC AATAACTGGAGGGAGGAGTTCCTAATCCAGGCAAGTCCTTCTGATCCCGAGAACTTCCCTTTCGTTGTTCTCGGGAACAAGATTGATGTTGATGGTGGAA ACAGCAGAGTCGTTTCCGAGAAAAAGGCTCGAGCCTGGTGTGCTTCCAAAGGCAATATCCCATACTTCGAGACCTCCGCAAAGGAAGGCATTAACGTTGA AGAAGCTTTCCAGGTCATAGCAAAGGATGCCTTGAAGACTGGAGAAGAGGAAGAAATGTAA
AA sequence Show only first row Show all	>Lus10023582 pacid=23160639 polypeptide=Lus10023582 locus=Lus10023582.g ID=Lus10023582.BGIv1.0 annot-version=v1.0 MPSRRRTLLKVIILGDSGYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQLNVQCMLLWQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNL NNWREEFLIQASPSDPENFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQVIAKDALKTGEEEEM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10023582 [exp]	0	1
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10040468 [exp]	2.0	0.9230
AT5G03345			unknown protein		Lus10026529 [exp]	4.6	0.8923
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Lus10007286 [exp]	5.3	0.9029
AT1G20575		DPMS1	dolichol phosphate mannose syn...		Lus10030748 [exp]	5.9	0.8949
AT2G32080		PUR ALPHA-1, PU...	purin-rich alpha 1 (.1.2)		Lus10001782 [exp]	6.5	0.9077
AT2G18390		HAL, ARL2, TTN5...	TITAN 5, HALLIMASCH, ARF-LIKE ...		Lus10026383 [exp]	6.9	0.9074
AT5G38660		APE1	acclimation of photosynthesis ...		Lus10034073 [exp]	7.3	0.8941
AT3G04780			Protein of unknown function (D...		Lus10020246 [exp]	11.5	0.8563
AT5G66410		PLP3B	phosducin-like protein 3 homol...		Lus10025176 [exp]	13.9	0.8418
AT5G64180			unknown protein		Lus10008120 [exp]	15.7	0.8509

Compare expression of checked genes

Lus10023582 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.