Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30830 65 / 1e-12 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43440 55 / 2e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G24530 55 / 3e-09 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G77330 54 / 7e-09 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59530 53 / 1e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19000 52 / 2e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G08640 52 / 4e-08 ATFLS1, FLS flavonol synthase 1 (.1.2) AT5G59540 51 / 4e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G03410 51 / 7e-08 2A6 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30840 50 / 7e-08 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024230 [exp] 221 / 9e-73 AT3G19000 149 / 3e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023602 [exp] 177 / 1e-55 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10031150 [exp] 76 / 7e-17 AT4G10490 114 / 1e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024232 [exp] 68 / 1e-14 AT5G20950 112 / 3e-29 Glycosyl hydrolase family protein (.1.2) Lus10021002 [exp] 60 / 4e-11 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10022196 [exp] 57 / 4e-10 AT5G59530 420 / 5e-147 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 57 / 4e-10 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10028678 [exp] 57 / 4e-10 AT1G77330 435 / 1e-154 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021203 [exp] 57 / 5e-10 AT1G06620 416 / 2e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G069200 [exp] 148 / 2e-44 AT3G19000 147 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.008G145300 [exp] 61 / 2e-11 AT4G21200 354 / 1e-121 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.008G165400 [exp] 58 / 3e-10 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.013G045000 [exp] 57 / 4e-10 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.005G182700 [exp] 56 / 7e-10 AT1G77330 461 / 4e-165 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.004G146100 [exp] 56 / 1e-09 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.010G096800 [exp] 55 / 2e-09 AT4G21200 362 / 8e-125 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.004G146000 [exp] 54 / 5e-09 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G135800 [exp] 54 / 5e-09 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073166 [exp] 54 / 6e-09 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10023600 pacid=23148255 polypeptide=Lus10023600 locus=Lus10023600.g ID=Lus10023600.BGIv1.0 annot-version=v1.0 ATGAGGAGAAGCGCAAGTTCAGCCCTGGAGATGGAGCGCCGTTGCCAGCTGGGTACAATCGTCAGCCCCTTCATCCCAAGGACAAGAATGAGTACCTTCT CGTTTTGGCTCCCCAATCCCCCCTTCAACGTCTACTCCACTCACCCTCCCCAACTCAGGGAGGTGGTGGAGGAGGTGTTCTTGTATCTAAGGAAGACCGG GACATTGATAGAAAGCATAATTAACGACTGCCTTGGTCTCCCTCCTGGGTATTTACAACAGTTTAACTCCGACAGGAATTGGGATTTCATGACCCCACTT CACTATTTCCCGGCGACGGACAGCGAGGACAATGGAATCACACCCCACCAGGACGGTAACTCCATTACCTTTGTGTTCCAGGACAATGCCGGAGGGTTGG AGGTCCTTAGAGGCAAGGACTGGATTCTGGCCACTCCCTCTCCGGACACCATTTTTTATAAATTCATACAAATATCCATATAA
AA sequence Show only first row Show all	>Lus10023600 pacid=23148255 polypeptide=Lus10023600 locus=Lus10023600.g ID=Lus10023600.BGIv1.0 annot-version=v1.0 MRRSASSALEMERRCQLGTIVSPFIPRTRMSTFSFWLPNPPFNVYSTHPPQLREVVEEVFLYLRKTGTLIESIINDCLGLPPGYLQQFNSDRNWDFMTPL HYFPATDSEDNGITPHQDGNSITFVFQDNAGGLEVLRGKDWILATPSPDTIFYKFIQISI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30830			2-oxoglutarate (2OG) and Fe(II...		Lus10023600 [exp]	0	1
AT4G18960	MADS	AG	AGAMOUS, K-box region and MADS...		Lus10002763 [exp]	6.2	0.8903
AT3G58780	MADS	AGL1, SHP1	SHATTERPROOF 1, AGAMOUS-like 1...		Lus10029275 [exp]	17.0	0.7499
					Lus10016313 [exp]	17.9	0.6842
AT5G15800	MADS	AGL2, SEP1	SEPALLATA1, AGAMOUS-like 2, K-...		Lus10034663 [exp]	24.3	0.7142
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	28.8	0.7065
					Lus10002303 [exp]	29.7	0.6790
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	32.2	0.7065
					Lus10011636 [exp]	35.2	0.7065
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	38.1	0.7065
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	40.7	0.7065

Compare expression of checked genes

Lus10023600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.