Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63600 40 / 2e-05 ATFLS5, FLS5 flavonol synthase 5 (.1.2) AT4G16765 39 / 6e-05 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G08640 39 / 7e-05 ATFLS1, FLS flavonol synthase 1 (.1.2) AT5G12270 37 / 0.0003 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G46500 36 / 0.0005 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT3G19010 36 / 0.0005 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024230 [exp] 103 / 2e-28 AT3G19000 149 / 3e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023602 [exp] 91 / 1e-23 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10031150 [exp] 57 / 2e-11 AT4G10490 114 / 1e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 42 / 7e-06 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10000711 [exp] 40 / 3e-05 AT5G24530 263 / 4e-86 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10035702 [exp] 39 / 0.0001 AT4G16330 347 / 4e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10037292 [exp] 37 / 0.0004 AT4G16330 416 / 5e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10025619 [exp] 36 / 0.0006 AT5G08640 349 / 5e-120 flavonol synthase 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G069200 [exp] 89 / 4e-23 AT3G19000 147 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.018G086800 [exp] 39 / 5e-05 AT1G35190 451 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.006G101200 [exp] 37 / 0.0002 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.007G047100 [exp] 37 / 0.0003 AT3G50210 503 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Potri.006G247700 [exp] 35 / 0.001 AT1G15550 328 / 2e-111 GA REQUIRING 4, ARABIDOPSIS THALIANA GIBBERELLIN 3 BETA-HYDROXYLASE 1, gibberellin 3-oxidase 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023601 pacid=23148350 polypeptide=Lus10023601 locus=Lus10023601.g ID=Lus10023601.BGIv1.0 annot-version=v1.0 ATGCACAGGGTGGTGAGGCCTCAAGGAAAGAGCCGATACTCGTACGCATTCTTCTACCACTTGTCCGGTGAGAAGTATGTGGAGCCATTGCCTGAGTTCA CGTCGGAAGTTGGGGAGCCGCCGCGATACCGCAAGTTTCTGTACGGGGAGTACTTGCAGCTGAGGCTTAGGAACAAAACTCCAGTATATATAACCCTTTT GTTTTAG
AA sequence Show only first row Show all	>Lus10023601 pacid=23148350 polypeptide=Lus10023601 locus=Lus10023601.g ID=Lus10023601.BGIv1.0 annot-version=v1.0 MHRVVRPQGKSRYSYAFFYHLSGEKYVEPLPEFTSEVGEPPRYRKFLYGEYLQLRLRNKTPVYITLLF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G08640		ATFLS1, FLS	flavonol synthase 1 (.1.2)		Lus10023601 [exp]	0	1
AT4G18590			Nucleic acid-binding, OB-fold-...		Lus10022705 [exp]	1.7	0.9635
					Lus10001343 [exp]	2.8	0.9516
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10024230 [exp]	3.2	0.9338
AT1G50660			unknown protein		Lus10002072 [exp]	3.5	0.9450
AT3G10520		ATGLB2, ARATHGL...	NON-SYMBIOTIC HAEMOGLOBIN 2, A...		Lus10038655 [exp]	4.0	0.9426
					Lus10028295 [exp]	4.9	0.9230
AT2G44060			Late embryogenesis abundant pr...		Lus10019367 [exp]	5.9	0.8978
AT3G26330		CYP71B37	"cytochrome P450, family 71, s...		Lus10033564 [exp]	6.0	0.8838
AT1G01420		UGT72B3	UDP-glucosyl transferase 72B3 ...		Lus10005334 [exp]	7.7	0.8769
AT5G01740			Nuclear transport factor 2 (NT...		Lus10001261 [exp]	7.7	0.8266

Compare expression of checked genes

Lus10023601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.