Plant FIBer expression Database

Lus10023627 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71750 264 / 4e-91 HGPT Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10024262
[exp]
360 / 5e-129 AT1G71750 259 / 3e-89 Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G198400
[exp]
317 / 4e-112 AT1G71750 270 / 3e-93 Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0533 PRTase-like PF00156 Pribosyltran Phosphoribosyl transferase domain
Representative CDS sequence
>Lus10023627 pacid=23148361 polypeptide=Lus10023627 locus=Lus10023627.g ID=Lus10023627.BGIv1.0 annot-version=v1.0
ATGGCTCTGGACTCTCACATAGACAAGGTCCTATGGAGCGCCGTCCAAATCTCCGACCGAGTCGCCAATCTCGCCGCGGAGATCACCGCCGATTTCTCCC
CTGATTCACCTGCTCCGGTCCTGGTCGGAGTCGCTACAGGCGCATTCGTCTTCCTGGCTGACCTGGCCAGGGAAATCAAGCTCCCGATTTCCGTGGATTT
CATTCGAGCCGATTCCTATGGCTCCGGAACCGAATCGAGCGGCGCCCCTAGGGTTTCTCTCGACCTGAAGATCGACGTGAAGGGGAAACACGTCATCGTC
GTGGAGGATATTGTGGATACGGGAAACACATTGGCGAGTTTGATCAGAGAGTTGGAAGGGAAGGGAGCATCTGCTGTTTCAGTTTGTACTTTCCTTGATA
AGCCTTCGAGGCGGAAGGTTCAGTTTCAGGTCGTGGGTAGTGGCAAGTACTACCATGGCTTTGAGTGTCCGGATTATTTTGTCGTTGGGTATGGAATGGA
CTTTGCTGAACTATACAGGAATCTGCCTTATGTTGGTGTCCTGAAGCCTGAGTTCTACAGTTGA
AA sequence
>Lus10023627 pacid=23148361 polypeptide=Lus10023627 locus=Lus10023627.g ID=Lus10023627.BGIv1.0 annot-version=v1.0
MALDSHIDKVLWSAVQISDRVANLAAEITADFSPDSPAPVLVGVATGAFVFLADLAREIKLPISVDFIRADSYGSGTESSGAPRVSLDLKIDVKGKHVIV
VEDIVDTGNTLASLIRELEGKGASAVSVCTFLDKPSRRKVQFQVVGSGKYYHGFECPDYFVVGYGMDFAELYRNLPYVGVLKPEFYS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Lus10023627
[exp]
0 1
AT1G44760 Adenine nucleotide alpha hydro... Lus10025644
[exp]
10.2 0.8286
AT1G80750 Ribosomal protein L30/L7 famil... Lus10040040
[exp]
12.6 0.8313
AT4G30000 Dihydropterin pyrophosphokinas... Lus10036922
[exp]
21.7 0.8245
AT4G12010 Disease resistance protein (TI... Lus10028060
[exp]
25.6 0.8242
Lus10030676
[exp]
33.2 0.8172
AT4G12490 Bifunctional inhibitor/lipid-t... Lus10032257
[exp]
46.6 0.7469
AT5G20850 ATRAD51 RAS associated with diabetes p... Lus10039928
[exp]
51.4 0.8178
AT3G07620 Exostosin family protein (.1) Lus10008751
[exp]
53.6 0.8174
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Lus10020664
[exp]
57.6 0.7520
Lus10010342
[exp]
58.5 0.7774

Lus10023627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.