Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46330 51 / 2e-10 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2) AT3G61640 50 / 6e-10 AGP20, ATAGP20 arabinogalactan protein 20 (.1) AT5G53250 47 / 8e-09 AGP22, ATAGP22 arabinogalactan protein 22 (.1) AT5G24105 46 / 2e-08 AGP41 arabinogalactan protein 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024263 [exp] 125 / 4e-40 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10037436 [exp] 101 / 2e-30 AT5G53250 51 / 2e-10 arabinogalactan protein 22 (.1) Lus10041273 [exp] 96 / 4e-28 AT3G61640 51 / 3e-10 arabinogalactan protein 20 (.1) Lus10000542 [exp] 42 / 8e-07 AT2G46330 63 / 6e-15 arabinogalactan protein 16 (.1.2) Lus10032355 [exp] 37 / 0.0002 AT3G61640 60 / 9e-13 arabinogalactan protein 20 (.1) Lus10033939 [exp] 36 / 0.0007 AT3G61640 61 / 4e-13 arabinogalactan protein 20 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G078801 [exp] 84 / 2e-23 ND / Potri.014G094800 [exp] 47 / 1e-08 AT3G61640 42 / 1e-06 arabinogalactan protein 20 (.1) Potri.012G032000 [exp] 45 / 4e-08 AT3G61640 66 / 3e-16 arabinogalactan protein 20 (.1) Potri.003G136600 [exp] 44 / 1e-07 AT5G53250 55 / 7e-12 arabinogalactan protein 22 (.1) Potri.001G094700 [exp] 44 / 2e-07 AT2G46330 57 / 7e-13 arabinogalactan protein 16 (.1.2) Potri.015G022600 [exp] 43 / 3e-07 AT5G53250 70 / 4e-18 arabinogalactan protein 22 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [flax] [poplar] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Lus10023629 pacid=23148378 polypeptide=Lus10023629 locus=Lus10023629.g ID=Lus10023629.BGIv1.0 annot-version=v1.0 ATGAGTTCCATGAAATTGTACGGCGCTCCGATCATCGGGTTCCTAATCTTAGCTCTTGCCCAGCTCGGTTATGGACAGGAAGGCTTAGCTCCTTCTCCTG CCGCCCAAGGTCCATCCAGCAATGATGGAGCGACAATTGATCAAGGAATTGCTTACCTTCTTCTCTTGGTGGCGCTTTCCATCACATACTTGATTCATTG A
AA sequence Show only first row Show all	>Lus10023629 pacid=23148378 polypeptide=Lus10023629 locus=Lus10023629.g ID=Lus10023629.BGIv1.0 annot-version=v1.0 MSSMKLYGAPIIGFLILALAQLGYGQEGLAPSPAAQGPSSNDGATIDQGIAYLLLLVALSITYLIH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10023629 [exp]	0	1
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Lus10015738 [exp]	1.0	0.9772
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Lus10003466 [exp]	1.4	0.9583
AT4G28400			Protein phosphatase 2C family ...		Lus10028094 [exp]	1.7	0.9514
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10022005 [exp]	2.2	0.9466
AT5G04410	NAC	NAC2, ANAC078	Arabidopsis NAC domain contain...		Lus10018810 [exp]	2.6	0.9202
AT2G17890		CPK16	calcium-dependent protein kina...		Lus10041914 [exp]	3.5	0.9495
AT4G28400			Protein phosphatase 2C family ...		Lus10040565 [exp]	4.9	0.9462
AT1G69840			SPFH/Band 7/PHB domain-contain...		Lus10036715 [exp]	6.6	0.9027
AT4G12720		ATNUDX7, GFG1, ...	GROWTH FACTOR GENE 1, Arabidop...		Lus10006365 [exp]	6.9	0.8993
AT2G22905			Expressed protein (.1)		Lus10012094 [exp]	7.5	0.9185

Compare expression of checked genes

Lus10023629 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.