Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G52342 42 / 3e-06 unknown protein AT1G24577 41 / 4e-06 unknown protein AT5G55980 42 / 5e-06 serine-rich protein-related (.1) AT3G13227 40 / 1e-05 serine-rich protein-related (.1) AT1G67910 40 / 2e-05 unknown protein AT3G56500 38 / 0.0001 serine-rich protein-related (.1) AT5G20370 38 / 0.0003 serine-rich protein-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043217 [exp] 66 / 1e-15 AT1G52342 48 / 7e-09 unknown protein Lus10034901 [exp] 39 / 3e-05 AT1G67910 49 / 6e-09 unknown protein Lus10000442 [exp] 38 / 7e-05 AT1G67910 56 / 1e-11 unknown protein Lus10008811 [exp] 37 / 0.0002 AT5G11090 61 / 2e-12 serine-rich protein-related (.1) Lus10026701 [exp] 37 / 0.0002 AT1G67910 56 / 5e-12 unknown protein Lus10023632 [exp] 37 / 0.0002 AT1G67910 48 / 1e-08 unknown protein Lus10006660 [exp] 38 / 0.0003 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2) Lus10038100 [exp] 38 / 0.0003 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2) Lus10039998 [exp] 37 / 0.0008 AT5G25280 157 / 3e-48 serine-rich protein-related (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G078900 [exp] 55 / 2e-11 AT3G13227 42 / 3e-06 serine-rich protein-related (.1) Potri.006G159300 [exp] 48 / 1e-08 AT1G24577 43 / 5e-07 unknown protein Potri.001G371400 [exp] 40 / 4e-05 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.006G060700 [exp] 39 / 4e-05 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.008G186200 [exp] 38 / 9e-05 AT1G67910 85 / 4e-23 unknown protein Potri.010G046700 [exp] 37 / 0.0002 AT1G67910 82 / 4e-22 unknown protein Potri.018G120300 [exp] 37 / 0.0003 AT5G11090 67 / 1e-14 serine-rich protein-related (.1) Potri.002G250700 [exp] 37 / 0.0005 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.018G079200 [exp] 36 / 0.0005 AT1G67910 45 / 9e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023630 pacid=23148273 polypeptide=Lus10023630 locus=Lus10023630.g ID=Lus10023630.BGIv1.0 annot-version=v1.0 ATGTGTCACCAGATTCTTCCCCATCCTCCGATCATCATCAGCCGCCGCCGGTGGGTGGTTCTACAAGGTATTAGTGATGATGAGGCACATGCAGCAGGGG AGGCAGAGAGAGAAGTCGGCGGCGGCGGGGGAACAAAGTTGTGTGTTTGTTCGCCTACCAGACATCCTGGATCGTTCAAGTGCAGGTATCATCGAGCTCA GTTTGTATGGAGAGCCGCCGGAAGCAGAATTACTACTACAGCAGCAGCAGCAGCAGCCACTGCCTGA
AA sequence Show only first row Show all	>Lus10023630 pacid=23148273 polypeptide=Lus10023630 locus=Lus10023630.g ID=Lus10023630.BGIv1.0 annot-version=v1.0 MCHQILPHPPIIISRRRWVVLQGISDDEAHAAGEAEREVGGGGGTKLCVCSPTRHPGSFKCRYHRAQFVWRAAGSRITTTAAAAAATA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67910			unknown protein		Lus10023630 [exp]	0	1
AT1G17050		SPS2	solanesyl diphosphate synthase...		Lus10042491 [exp]	1.0	0.9254
AT5G67570		EMB246, DG1, EM...	EMBRYO DEFECTIVE 246, embryo d...		Lus10025202 [exp]	4.2	0.9050
AT2G21370		XK1, XK-1	XYLULOSE KINASE 1, xylulose ki...		Lus10017967 [exp]	5.7	0.9108
AT3G14630		CYP72A9	"cytochrome P450, family 72, s...		Lus10002311 [exp]	7.1	0.8715
AT1G13920			Remorin family protein (.1)		Lus10004665 [exp]	10.5	0.9155
AT4G35000		APX3	ascorbate peroxidase 3 (.1)		Lus10000180 [exp]	12.1	0.9155
AT2G41200			unknown protein		Lus10032687 [exp]	13.9	0.8828
AT1G35470			SPla/RYanodine receptor (SPRY)...		Lus10020190 [exp]	14.7	0.9142
AT3G55740		ATPROT2, ProT2	proline transporter 2 (.1.2)		Lus10040238 [exp]	17.0	0.8853
AT5G36930			Disease resistance protein (TI...		Lus10004726 [exp]	17.3	0.9133

Compare expression of checked genes

Lus10023630 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.