Lus10023632 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G67910 49 / 5e-09 unknown protein
AT3G13227 46 / 1e-07 serine-rich protein-related (.1)
AT1G24577 45 / 2e-07 unknown protein
AT5G20370 44 / 1e-06 serine-rich protein-related (.1)
AT5G55980 43 / 2e-06 serine-rich protein-related (.1)
AT3G56500 43 / 2e-06 serine-rich protein-related (.1)
AT5G25280 42 / 6e-06 serine-rich protein-related (.1.2)
AT5G11090 41 / 2e-05 serine-rich protein-related (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034901 148 / 3e-48 AT1G67910 49 / 6e-09 unknown protein
Lus10011094 62 / 4e-14 AT5G55980 44 / 1e-06 serine-rich protein-related (.1)
Lus10043215 56 / 1e-11 AT5G55980 44 / 8e-07 serine-rich protein-related (.1)
Lus10023227 44 / 9e-07 AT5G55980 69 / 3e-16 serine-rich protein-related (.1)
Lus10008880 44 / 9e-07 AT5G55980 63 / 1e-13 serine-rich protein-related (.1)
Lus10006660 44 / 2e-06 AT5G25280 144 / 4e-43 serine-rich protein-related (.1.2)
Lus10000442 41 / 4e-06 AT1G67910 56 / 1e-11 unknown protein
Lus10008808 43 / 5e-06 AT5G25280 153 / 2e-46 serine-rich protein-related (.1.2)
Lus10038100 43 / 5e-06 AT5G25280 145 / 4e-43 serine-rich protein-related (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G079200 74 / 6e-19 AT1G67910 45 / 9e-08 unknown protein
Potri.010G046700 47 / 4e-08 AT1G67910 82 / 4e-22 unknown protein
Potri.018G120300 46 / 7e-08 AT5G11090 67 / 1e-14 serine-rich protein-related (.1)
Potri.008G186200 45 / 2e-07 AT1G67910 85 / 4e-23 unknown protein
Potri.001G371400 46 / 3e-07 AT5G55980 50 / 2e-08 serine-rich protein-related (.1)
Potri.006G060700 44 / 7e-07 AT5G11090 66 / 4e-14 serine-rich protein-related (.1)
Potri.006G159300 42 / 2e-06 AT1G24577 43 / 5e-07 unknown protein
Potri.002G250700 42 / 5e-06 AT3G56500 43 / 5e-06 serine-rich protein-related (.1)
Potri.018G078900 40 / 8e-06 AT3G13227 42 / 3e-06 serine-rich protein-related (.1)
Potri.006G060800 41 / 2e-05 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2)
PFAM info
Representative CDS sequence
>Lus10023632 pacid=23148296 polypeptide=Lus10023632 locus=Lus10023632.g ID=Lus10023632.BGIv1.0 annot-version=v1.0
ATGGCTTCTCACGGAAGCCTAACGGTTTCAGTTACCTCACCGAAAGGCGGCGGCACCGATAGGGAAGGCGCCGGAAGGCCTACTACCGGTGGGCAGTGCT
TGTGCTCGCCGACGACGCACCCGGGATCCTTTAGGTGCAGGCTCCATCGTACTTCTTCTTCATCAGCGGCTTGGAGTAAGATGAAACGATCATCTTCCAT
CCCAGCTTATGAAACTTCTGCTGCTCATAACTCTTCTACTTGTACTTCTCCCAATTCTGTTGAATCTGCTTGA
AA sequence
>Lus10023632 pacid=23148296 polypeptide=Lus10023632 locus=Lus10023632.g ID=Lus10023632.BGIv1.0 annot-version=v1.0
MASHGSLTVSVTSPKGGGTDREGAGRPTTGGQCLCSPTTHPGSFRCRLHRTSSSSAAWSKMKRSSSIPAYETSAAHNSSTCTSPNSVESA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G67910 unknown protein Lus10023632 0 1
AT1G02400 ATGA2OX4, ATGA2... DOWNSTREAM TARGET OF AGL15 1, ... Lus10037816 2.8 0.9659
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011979 4.2 0.9666
AT2G45510 CYP704A2 "cytochrome P450, family 704, ... Lus10038896 4.6 0.9614
AT5G65660 hydroxyproline-rich glycoprote... Lus10028220 4.9 0.9542
AT1G02400 ATGA2OX4, ATGA2... DOWNSTREAM TARGET OF AGL15 1, ... Lus10017094 8.9 0.9559
AT1G49570 Peroxidase superfamily protein... Lus10009901 10.5 0.9396
AT2G27970 CKS2 CDK-subunit 2 (.1) Lus10036579 11.3 0.9496
AT5G03860 MLS malate synthase (.1.2) Lus10020565 11.8 0.9568
AT3G11260 HD WOX5B, WOX5 WUSCHEL related homeobox 5B, W... Lus10028271 12.2 0.9440
AT1G12780 ATUGE1, UGE1 A. THALIANA UDP-GLC 4-EPIMERAS... Lus10029572 13.6 0.9603

Lus10023632 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.