Lus10023638 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G48830 330 / 4e-117 Ribosomal protein S7e family protein (.1.2)
AT3G02560 314 / 6e-111 Ribosomal protein S7e family protein (.1.2)
AT5G16130 311 / 7e-110 Ribosomal protein S7e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034909 385 / 5e-139 AT1G48830 331 / 1e-117 Ribosomal protein S7e family protein (.1.2)
Lus10017497 348 / 5e-124 AT1G48830 325 / 3e-115 Ribosomal protein S7e family protein (.1.2)
Lus10028789 351 / 4e-122 AT1G48830 330 / 2e-113 Ribosomal protein S7e family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G115400 322 / 7e-114 AT3G02560 315 / 4e-111 Ribosomal protein S7e family protein (.1.2)
Potri.016G100400 322 / 8e-114 AT3G02560 313 / 1e-110 Ribosomal protein S7e family protein (.1.2)
Potri.004G099200 321 / 2e-113 AT3G02560 314 / 6e-111 Ribosomal protein S7e family protein (.1.2)
Potri.006G087900 320 / 3e-113 AT3G02560 316 / 2e-111 Ribosomal protein S7e family protein (.1.2)
Potri.015G046100 104 / 1e-29 AT1G48830 110 / 1e-32 Ribosomal protein S7e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0652 S24e_L23_L15e PF01251 Ribosomal_S7e Ribosomal protein S7e
Representative CDS sequence
>Lus10023638 pacid=23148301 polypeptide=Lus10023638 locus=Lus10023638.g ID=Lus10023638.BGIv1.0 annot-version=v1.0
ATGTATACGTCAAAGCAGAAGATTCACAAAGATAAAGATGTTGAACCCTCCGAGTTTGAGGAGTCGGTTGCACAGGCATTGTTTGATTTGGAGAACACCA
ACCAGGAGATGAAAAGTGAACTGAAGGATCTCTACATCAACACAGCAACTCAAATGGATGTCTCAGGTGGCCGCAAGGCAGTTGTCATCCATGTTCCTTA
CAGATTGAGGAAAGCATACAGGAAGATTCATAGTAGGCTTGTTAGGGAGCTTGAGAAGAAGTTCAGTGGGAAGGATGTGGTTGTGATTGCTACCCGAAGA
ATTGTGAGGCCACCAAAGAAAGGATCAGCTGCACAAAGGCCTCGCAGCCGCACACTGACTTCTGTTCATGAGGCGATACTAGATGATGTTGTGCTGCCTG
CTGAGATTGTTGGCAAGAGAACCAGATACCGTGTTGATGGAACCAAGATAATGAAGGTGTTTTTGGACCCAAAGGAACAGAACAACACAGAGTACAAACT
GGAGACCTTTACTTCTGTTTACAGGAAACTTACTGGGAAGGATGTTGTGTTCGAGTTCAGGCCAACTGAGGCATAG
AA sequence
>Lus10023638 pacid=23148301 polypeptide=Lus10023638 locus=Lus10023638.g ID=Lus10023638.BGIv1.0 annot-version=v1.0
MYTSKQKIHKDKDVEPSEFEESVAQALFDLENTNQEMKSELKDLYINTATQMDVSGGRKAVVIHVPYRLRKAYRKIHSRLVRELEKKFSGKDVVVIATRR
IVRPPKKGSAAQRPRSRTLTSVHEAILDDVVLPAEIVGKRTRYRVDGTKIMKVFLDPKEQNNTEYKLETFTSVYRKLTGKDVVFEFRPTEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G48830 Ribosomal protein S7e family p... Lus10023638 0 1
AT1G48830 Ribosomal protein S7e family p... Lus10034909 1.0 0.9871
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10030113 2.8 0.9675
AT4G09320 NDPK1 Nucleoside diphosphate kinase ... Lus10003844 4.9 0.9637
AT2G20450 Ribosomal protein L14 (.1) Lus10011807 5.9 0.9627
AT1G67430 Ribosomal protein L22p/L17e fa... Lus10006421 6.7 0.9638
AT3G51800 ATEBP1, ATG2, E... A. THALIANA ERBB-3 BINDING PRO... Lus10005046 8.5 0.9579
AT5G59850 Ribosomal protein S8 family pr... Lus10040309 8.9 0.9451
AT3G06700 Ribosomal L29e protein family ... Lus10016875 9.5 0.9544
AT4G14320 Zinc-binding ribosomal protein... Lus10038130 10.2 0.9518
AT2G44120 Ribosomal protein L30/L7 famil... Lus10004220 11.0 0.9590

Lus10023638 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.