Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24570 299 / 1e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT5G43140 75 / 3e-16 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT2G14860 61 / 3e-11 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G14305 57 / 3e-10 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT4G33905 55 / 7e-09 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G04470 53 / 2e-08 PMP22 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT5G19750 52 / 6e-08 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) AT4G03410 49 / 5e-07 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) AT1G52870 49 / 1e-06 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034922 [exp] 414 / 3e-149 AT3G24570 330 / 4e-116 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10038626 [exp] 247 / 1e-83 AT3G24570 273 / 1e-93 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10037900 [exp] 225 / 4e-74 AT3G24570 246 / 3e-82 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10022130 [exp] 205 / 7e-67 AT3G24570 256 / 6e-87 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10011679 [exp] 202 / 8e-66 AT3G24570 249 / 2e-84 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10002118 [exp] 72 / 6e-15 AT2G14860 292 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10011424 [exp] 72 / 1e-14 AT2G14860 288 / 3e-98 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10018700 [exp] 63 / 2e-11 AT5G43140 253 / 2e-83 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Lus10012098 [exp] 60 / 1e-10 AT5G19750 259 / 4e-86 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G081600 [exp] 321 / 8e-113 AT3G24570 309 / 7e-108 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.018G037100 [exp] 273 / 1e-93 AT3G24570 289 / 6e-100 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.006G242700 [exp] 204 / 5e-67 AT3G24570 214 / 4e-71 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.006G032500 [exp] 64 / 7e-12 AT5G19750 279 / 8e-94 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.016G029700 [exp] 64 / 7e-12 AT5G19750 257 / 5e-85 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.001G296400 [exp] 61 / 7e-11 AT2G14860 300 / 6e-103 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.009G090600 [exp] 59 / 2e-10 AT4G33905 299 / 1e-102 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.011G007100 [exp] 52 / 3e-08 AT4G04470 230 / 1e-77 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1) Potri.001G404600 [exp] 47 / 3e-06 AT1G52870 438 / 6e-154 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Potri.011G123700 [exp] 47 / 3e-06 AT1G52870 472 / 1e-167 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04117 [flax] [poplar] Mpv17_PMP22 Mpv17 / PMP22 family
Representative CDS sequence Show only first row Show all	>Lus10023648 pacid=23148307 polypeptide=Lus10023648 locus=Lus10023648.g ID=Lus10023648.BGIv1.0 annot-version=v1.0 ATGTTGATGAAGCTATGGAGTTGGTACAGCCACTGCTTATCTTCCCACCCTTTGAAGACCCAGGTAATCAGCTCCGGTGTCCTCTGGGGGCTTGGCGACA TCGGTGCTCAATACGTCACTCATTGCACAGCCATTAAGCACATTCACTCTACCCAGGATAAAGAGAATGCTTTCAGAATCGATTGGAAGCGTGCAGCTAT TACCAGCGCATTTGGCTTTGGCTTTGTTGGTCCAGTTGGCCACTTCTGGTATGAGAACTTGGACAAGATCATAACTACCAGGCTTAAACTAGCACCTAAG TCGGCTCGGTTTGTGGCTGCTAAAGTGGCAGCTGATGGCATAATCTTTGGCCCTTTAGATTTGCTAGTGTTTTTCAGTTACATGGGATTTGCAACTGGCA AGAATGCTGCTCGAGTGAAAGAAGATGTGAAAAGGGACTTCCTGCCATCATTGATAGTGGAAGGTGGTATTTGGCCCATCGTTCAGGTTGCAAACTTCAG ATATATACCAGTACAGTACCAACTTCTCTACGTCAATTTGTTTTGCTTGATAGACAGTGCCTTCTTGTCATGGGTGGAGCAACAAAAAGATGCTCCTTGG AAACAGTGGTTCAAATCAATTGAGCCTCTCAAGGAGAGAGGTGGTCATGGCGGATTATGA
AA sequence Show only first row Show all	>Lus10023648 pacid=23148307 polypeptide=Lus10023648 locus=Lus10023648.g ID=Lus10023648.BGIv1.0 annot-version=v1.0 MLMKLWSWYSHCLSSHPLKTQVISSGVLWGLGDIGAQYVTHCTAIKHIHSTQDKENAFRIDWKRAAITSAFGFGFVGPVGHFWYENLDKIITTRLKLAPK SARFVAAKVAADGIIFGPLDLLVFFSYMGFATGKNAARVKEDVKRDFLPSLIVEGGIWPIVQVANFRYIPVQYQLLYVNLFCLIDSAFLSWVEQQKDAPW KQWFKSIEPLKERGGHGGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10023648 [exp]	0	1
AT3G24570			Peroxisomal membrane 22 kDa (M...		Lus10034922 [exp]	1.0	0.8690
AT1G56310			Polynucleotidyl transferase, r...		Lus10010930 [exp]	4.6	0.8446
AT4G27870			Vacuolar iron transporter (VIT...		Lus10035731 [exp]	17.7	0.8043
AT1G11890		ATSEC22, SEC22	SECRETION 22, Synaptobrevin fa...		Lus10036987 [exp]	25.8	0.8531
AT5G63460			SAP domain-containing protein ...		Lus10016762 [exp]	26.4	0.8513
AT3G51000			alpha/beta-Hydrolases superfam...		Lus10041790 [exp]	33.9	0.8442
AT1G70350			unknown protein		Lus10013008 [exp]	35.7	0.8198
AT3G16230			Predicted eukaryotic LigT (.1....		Lus10037578 [exp]	37.8	0.8472
AT1G76010			Alba DNA/RNA-binding protein (...		Lus10017255 [exp]	38.8	0.8141
AT1G12230			Aldolase superfamily protein (...		Lus10024606 [exp]	45.5	0.8305

Compare expression of checked genes

Lus10023648 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.