Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034929 [exp] 61 / 1e-13 AT4G28990 59 / 2e-11 RNA-binding protein-related (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023658 pacid=23148242 polypeptide=Lus10023658 locus=Lus10023658.g ID=Lus10023658.BGIv1.0 annot-version=v1.0 ATGGGGTCCAGAGACAAGGGCCATAGCGCGTCGCACCACCACCCGCCGCTCCTAAGCAGCCTGGTCATACGGCCATCAGCTAGCGACGGCGGGGAAGGTA GAAGTAACGGAAGCGCTGGCGGAGGACGTGGAGGGGAGTATGAAGCGGGCAAGGTGCGGCACGAGCTTCCTCCCTATTCCCGAATTGAGCGGTTTTCGGC TGATACTGGTTTGTGTCTCTTCCTTCCTACATCTGTAGATCTGTTATGA
AA sequence Show only first row Show all	>Lus10023658 pacid=23148242 polypeptide=Lus10023658 locus=Lus10023658.g ID=Lus10023658.BGIv1.0 annot-version=v1.0 MGSRDKGHSASHHHPPLLSSLVIRPSASDGGEGRSNGSAGGGRGGEYEAGKVRHELPPYSRIERFSADTGLCLFLPTSVDLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023658 [exp]	0	1
AT5G16380			Protein of unknown function, D...		Lus10026841 [exp]	10.1	0.6473
AT5G19910		MED31	SOH1 family protein (.1.2)		Lus10021434 [exp]	14.7	0.6425
AT3G05545			RING/U-box superfamily protein...		Lus10029886 [exp]	15.3	0.6599
AT4G35070			SBP (S-ribonuclease binding pr...		Lus10017276 [exp]	22.8	0.6118
AT3G07260	FHA		SMAD/FHA domain-containing pro...		Lus10038196 [exp]	25.3	0.6456
AT1G65820			microsomal glutathione s-trans...		Lus10007373 [exp]	26.4	0.6348
AT5G55160		ATSUMO2, SUMO2,...	small ubiquitin-like modifier ...		Lus10032561 [exp]	30.3	0.6429
AT3G07480			2Fe-2S ferredoxin-like superfa...		Lus10009568 [exp]	50.4	0.6143
AT1G53900			Eukaryotic translation initiat...		Lus10037452 [exp]	60.2	0.6082
AT3G02210		COBL1	COBRA-like protein 1 precursor...		Lus10012598 [exp]	68.1	0.6029

Compare expression of checked genes

Lus10023658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.