Lus10023662 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G65980 265 / 5e-92 TPX1 thioredoxin-dependent peroxidase 1 (.1.2)
AT1G65970 256 / 1e-88 TPX2 thioredoxin-dependent peroxidase 2 (.1)
AT1G60740 253 / 2e-87 Thioredoxin superfamily protein (.1)
AT1G65990 185 / 2e-56 type 2 peroxiredoxin-related / thiol specific antioxidant / mal allergen family protein (.1)
AT3G52960 175 / 6e-56 Thioredoxin superfamily protein (.1)
AT3G06050 106 / 3e-29 PRXIIF, ATPRXIIF peroxiredoxin IIF (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023180 314 / 2e-111 AT1G65980 268 / 2e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10015077 312 / 7e-111 AT1G65980 268 / 3e-93 thioredoxin-dependent peroxidase 1 (.1.2)
Lus10003373 180 / 9e-58 AT3G52960 291 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10002843 178 / 4e-57 AT3G52960 290 / 3e-100 Thioredoxin superfamily protein (.1)
Lus10021932 109 / 1e-29 AT3G06050 317 / 6e-111 peroxiredoxin IIF (.1)
Lus10041218 93 / 1e-22 AT3G06050 243 / 3e-79 peroxiredoxin IIF (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G083500 277 / 4e-97 AT1G65980 280 / 4e-98 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.001G423500 277 / 5e-97 AT1G65980 285 / 5e-100 thioredoxin-dependent peroxidase 1 (.1.2)
Potri.013G102100 178 / 4e-57 AT3G52960 278 / 1e-95 Thioredoxin superfamily protein (.1)
Potri.019G024000 99 / 2e-26 AT3G06050 311 / 2e-109 peroxiredoxin IIF (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF08534 Redoxin Redoxin
Representative CDS sequence
>Lus10023662 pacid=23148272 polypeptide=Lus10023662 locus=Lus10023662.g ID=Lus10023662.BGIv1.0 annot-version=v1.0
ATGGCTCCCATCGCTGCCGGTGCTACCTTGCCTGAGGGAACCCTCGCTTTCTTCGATGAGAACGATCAGCTCCAGCAGGTCTCCATCCACTCACTCGCCG
CCGGCAAGAAGGTTGTCATCGTTGGCGTTCCCGGCGCATTTACTCCTACCTGCAGCTTGAAGCATGTTCCTGGATTCATCGAGAGAGCTGGGGATCTCAA
AGCTAAGGGCGTTGCTGAGATCATCACTATTAGCGTGAATGATCCATTTGTGATGAAGGCTTGGTCCAAGACATTCCCAGAGAACAAAGACGTTAAGTTC
TTGGCTGATGGATCTGCGACATACACCCATGCTCTGGGTCTTGAGCTTGATTTGAACGAGAAGGGTCTAGGAATCAGGTCAAGGAGGTTTGCTCTGTTGG
TCGATGACCTCAAAGTGAAGGCTGCAAACGTTGAAGAAGGTGGTGACTTCACTGTTTCCAGCGTTGATGACATTATCAAGGCACTTGATGCTTGA
AA sequence
>Lus10023662 pacid=23148272 polypeptide=Lus10023662 locus=Lus10023662.g ID=Lus10023662.BGIv1.0 annot-version=v1.0
MAPIAAGATLPEGTLAFFDENDQLQQVSIHSLAAGKKVVIVGVPGAFTPTCSLKHVPGFIERAGDLKAKGVAEIITISVNDPFVMKAWSKTFPENKDVKF
LADGSATYTHALGLELDLNEKGLGIRSRRFALLVDDLKVKAANVEEGGDFTVSSVDDIIKALDA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G65980 TPX1 thioredoxin-dependent peroxida... Lus10023662 0 1
AT1G17530 ATTIM23-1 translocase of inner mitochond... Lus10008470 2.8 0.9271
AT1G36730 Translation initiation factor ... Lus10004057 3.9 0.9015
AT3G44150 unknown protein Lus10029366 4.2 0.9238
AT3G43520 Transmembrane proteins 14C (.1... Lus10027640 6.6 0.9206
AT2G27510 ATFD3 ferredoxin 3 (.1) Lus10034144 8.9 0.9095
AT4G37830 cytochrome c oxidase-related (... Lus10019250 9.9 0.9228
AT1G07890 ATAPX01, CS1, A... maternal effect embryo arrest ... Lus10013537 10.2 0.9168
AT5G58590 RANBP1 RAN binding protein 1 (.1) Lus10037241 10.4 0.8990
AT3G47810 ATVPS29, MAG1 VACUOLAR PROTEIN SORTING 29, M... Lus10030497 11.0 0.9075
AT4G13870 WRNEXO, ATWRNEX... Werner syndrome-like exonuclea... Lus10039164 13.2 0.9161

Lus10023662 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.