Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023664 [exp] 62 / 5e-14 AT1G51660 52 / 5e-09 ARABIDOPSIS THALIANA MITOGEN-ACTIVATED PROTEIN KINASE KINASE 4, mitogen-activated protein kinase kinase 4 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023665 pacid=23148387 polypeptide=Lus10023665 locus=Lus10023665.g ID=Lus10023665.BGIv1.0 annot-version=v1.0 ATGACTCTTCTCGCATCGATATGCTTCACTTACTCTCCAGATCCTTCCTCAAAAAAATGGGGAGAAACTCACCCGGAAATGAAACTGCAAAACCATGTTG GCACAGACGGGGTGCTCCAGGAGGCTCCACCTCACAAATCGCCTTCATCAGGATCAGGCATTCCCCGTACTTCACCGGCGGCACTCCATCAATCGGATAC GTTCTCAAGTGCACCTCGAAGACATTCATCCTGA
AA sequence Show only first row Show all	>Lus10023665 pacid=23148387 polypeptide=Lus10023665 locus=Lus10023665.g ID=Lus10023665.BGIv1.0 annot-version=v1.0 MTLLASICFTYSPDPSSKKWGETHPEMKLQNHVGTDGVLQEAPPHKSPSSGSGIPRTSPAALHQSDTFSSAPRRHSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023665 [exp]	0	1
AT1G51660		ATMKK4, ATMEK4	ARABIDOPSIS THALIANA MITOGEN-A...		Lus10023664 [exp]	1.0	0.9706
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Lus10029185 [exp]	6.3	0.8976
AT1G16390		3-Oct, ATOCT3	organic cation/carnitine trans...		Lus10005825 [exp]	14.3	0.9013
AT3G11080		AtRLP35	receptor like protein 35 (.1)		Lus10028053 [exp]	14.6	0.8495
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10005594 [exp]	16.0	0.9002
AT5G57330			Galactose mutarotase-like supe...		Lus10000414 [exp]	27.5	0.8494
AT5G38760			Late embryogenesis abundant pr...		Lus10003046 [exp]	32.3	0.8917
					Lus10008051 [exp]	38.4	0.8967
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Lus10011630 [exp]	39.1	0.8824
					Lus10027563 [exp]	41.6	0.8269

Compare expression of checked genes

Lus10023665 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.