Lus10023675 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G24060 162 / 3e-52 Plant self-incompatibility protein S1 family (.1)
AT4G16195 57 / 7e-11 Plant self-incompatibility protein S1 family (.1)
AT5G06020 54 / 9e-10 Plant self-incompatibility protein S1 family (.1)
AT1G04645 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
AT4G24975 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
AT1G26798 51 / 1e-08 Plant self-incompatibility protein S1 family (.1)
AT1G26799 51 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT1G11765 50 / 2e-08 Plant self-incompatibility protein S1 family (.1)
AT1G28305 50 / 3e-08 Plant self-incompatibility protein S1 family (.1)
AT4G24973 49 / 4e-08 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011754 217 / 2e-74 AT3G24060 152 / 1e-48 Plant self-incompatibility protein S1 family (.1)
Lus10017719 190 / 3e-63 AT3G24060 157 / 4e-50 Plant self-incompatibility protein S1 family (.1)
Lus10033675 92 / 6e-25 AT3G24060 72 / 4e-17 Plant self-incompatibility protein S1 family (.1)
Lus10030565 64 / 2e-13 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1)
Lus10038164 60 / 4e-12 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10038163 53 / 2e-09 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1)
Lus10025935 52 / 3e-09 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1)
Lus10025937 52 / 2e-08 AT3G26880 68 / 4e-14 Plant self-incompatibility protein S1 family (.1)
Lus10022830 50 / 3e-08 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G175200 205 / 3e-69 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
Potri.001G053100 203 / 2e-68 AT3G24060 171 / 2e-55 Plant self-incompatibility protein S1 family (.1)
Potri.001G053300 80 / 1e-19 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 79 / 4e-19 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.010G008300 75 / 7e-18 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.003G175100 61 / 2e-12 ND /
Potri.016G066900 61 / 3e-12 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.002G252500 59 / 1e-11 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.001G053200 56 / 1e-10 AT3G24060 56 / 1e-10 Plant self-incompatibility protein S1 family (.1)
Potri.002G263900 54 / 5e-10 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10023675 pacid=23148303 polypeptide=Lus10023675 locus=Lus10023675.g ID=Lus10023675.BGIv1.0 annot-version=v1.0
ATGAGAATCACCAAGAAAATGCTTCTTCTCTTCCTCTGCCTTACAGTGGGGATCATCTTCTTCTCAGCTTACGACGACCGACAGCAGTACTTCTGGATGC
AGCTAGATTACGATGTTCGTGTCATCAACGGCTTCACCAACAACTCATCCCTTCCCCTAGTCATATGGTGCTCATCCGGTGACAATGATCTTGGAGGTCG
AGCCCTTCAGGAAGGCGAAGACTTCGGCTGGAGCCTCCGGACCAAGTTCTGGGGCAGCAACATTTTCTTGTGTACCATGAAGTGGGATGCCAGGAGGAGG
AAGTTCGACGCTTTTAAGGTTCCTAGGGATGTTCAGCGATGCAGCCCTACGAGGAAGTGCTCGTGGTTGGTTAGAGAGGATGGCTTCTATTTCAGCAGCG
ATGAAGTTAACTGGAACAAAGACTTCTCTTGGTCCTGA
AA sequence
>Lus10023675 pacid=23148303 polypeptide=Lus10023675 locus=Lus10023675.g ID=Lus10023675.BGIv1.0 annot-version=v1.0
MRITKKMLLLFLCLTVGIIFFSAYDDRQQYFWMQLDYDVRVINGFTNNSSLPLVIWCSSGDNDLGGRALQEGEDFGWSLRTKFWGSNIFLCTMKWDARRR
KFDAFKVPRDVQRCSPTRKCSWLVREDGFYFSSDEVNWNKDFSWS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24060 Plant self-incompatibility pro... Lus10023675 0 1
AT3G48530 KING1 SNF1-related protein kinase re... Lus10016763 7.1 0.8476
AT3G54480 SKP5, SKIP5 SKP1/ASK-interacting protein 5... Lus10039556 12.8 0.8309
AT3G07370 ATCHIP, CHIP carboxyl terminus of HSC70-int... Lus10020412 16.2 0.7856
AT3G19990 unknown protein Lus10017359 29.6 0.7905
AT5G25360 unknown protein Lus10005466 37.7 0.7623
AT5G50530 CBS / octicosapeptide/Phox/Bem... Lus10032625 39.0 0.7999
AT4G30310 FGGY family of carbohydrate ki... Lus10001312 44.9 0.7897
AT1G67310 CAMTA Calmodulin-binding transcripti... Lus10011352 48.8 0.7794
AT3G48530 KING1 SNF1-related protein kinase re... Lus10022458 50.0 0.8012
AT5G04980 DNAse I-like superfamily prote... Lus10033398 53.5 0.7663

Lus10023675 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.