Lus10023680 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G63930 196 / 6e-59 Leucine-rich repeat protein kinase family protein (.1)
AT2G33170 187 / 8e-56 Leucine-rich repeat receptor-like protein kinase family protein (.1)
AT1G17230 161 / 1e-46 Leucine-rich receptor-like protein kinase family protein (.1)
AT1G34110 119 / 5e-32 Leucine-rich receptor-like protein kinase family protein (.1)
AT4G28650 118 / 9e-32 Leucine-rich repeat transmembrane protein kinase family protein (.1)
AT1G08590 116 / 5e-31 Leucine-rich receptor-like protein kinase family protein (.1)
AT5G61480 114 / 2e-30 PXY, TDR TDIF receptor, PHLOEM INTERCALATED WITH XYLEM, Leucine-rich repeat protein kinase family protein (.1)
AT3G24240 112 / 2e-29 Leucine-rich repeat receptor-like protein kinase family protein (.1)
AT1G75820 110 / 1e-28 ATCLV1, FLO5, FAS3, CLV1 FLOWER DEVELOPMENT 5, FASCIATA 3, CLAVATA 1, Leucine-rich receptor-like protein kinase family protein (.1)
AT3G49670 109 / 2e-28 BAM2 BARELY ANY MERISTEM 2, Leucine-rich receptor-like protein kinase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011761 278 / 5e-89 AT5G63930 913 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Lus10017782 121 / 1e-32 AT1G34110 1467 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10018911 120 / 2e-32 AT3G24240 1033 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1)
Lus10028612 117 / 3e-31 AT5G48940 1051 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Lus10000509 117 / 3e-31 AT1G34110 1464 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10027951 115 / 2e-30 AT1G08590 1256 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10000814 115 / 2e-30 AT1G08590 1263 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10025943 115 / 2e-30 AT4G28650 1284 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
Lus10003503 109 / 2e-30 AT1G72180 278 / 2e-87 Leucine-rich receptor-like protein kinase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G174900 218 / 8e-67 AT2G33170 1348 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1)
Potri.001G053400 216 / 4e-66 AT2G33170 1311 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1)
Potri.013G051300 208 / 3e-63 AT5G63930 1281 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.019G025500 205 / 4e-62 AT5G63930 1320 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Potri.011G139700 162 / 5e-47 AT1G17230 1363 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.013G048800 124 / 2e-33 AT1G08590 1306 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.019G021700 120 / 2e-32 AT1G08590 1286 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.005G198000 118 / 1e-31 AT1G34110 1381 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.002G063300 117 / 2e-31 AT1G34110 1400 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1)
Potri.002G256500 117 / 4e-31 AT4G28650 1339 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0016 PKinase PF00069 Pkinase Protein kinase domain
Representative CDS sequence
>Lus10023680 pacid=23148294 polypeptide=Lus10023680 locus=Lus10023680.g ID=Lus10023680.BGIv1.0 annot-version=v1.0
ATGTCTGCAGTTGCTGGATCTTATGGATATATTGCACCTGAATATGCATACACGATGAAGGTGACAGAAAAATGCGACATCTACAGCTACGGAGTTGTTC
TGTTGGAGTTGCTAACTGGAAGAACTCCGGTACAGCCTATAGAACAAGGAGGAGATCTTGTGACATGGGTGAAACAATATATCCGCGAGCATTCACTATC
CCCCGGAATACTTGATCATAGATTAAAGCTTGAAGATCGAAGAATCATTGATCACATGATAACAGTGATGAAAATTGCTCTCGTCTGCGCAAGTATATCC
CCATTTGACCGGCCATCGATGCGAGAAGTTGTACTGATGCTGATCGAGTCGAATGAGCAACAGGGGAACTTGATTGAGTTCCCAAATAATGATGTTCATC
TGATAGAGGAAGAAGAGGGTGCTCCATAA
AA sequence
>Lus10023680 pacid=23148294 polypeptide=Lus10023680 locus=Lus10023680.g ID=Lus10023680.BGIv1.0 annot-version=v1.0
MSAVAGSYGYIAPEYAYTMKVTEKCDIYSYGVVLLELLTGRTPVQPIEQGGDLVTWVKQYIREHSLSPGILDHRLKLEDRRIIDHMITVMKIALVCASIS
PFDRPSMREVVLMLIESNEQQGNLIEFPNNDVHLIEEEEGAP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G63930 Leucine-rich repeat protein ki... Lus10023680 0 1
AT2G38120 MAP1, WAV5, PIR... WAVY ROOTS 5, MODIFIER OF ARF7... Lus10002498 3.5 0.9005
AT4G28640 AUX_IAA IAA11 indole-3-acetic acid inducible... Lus10022868 3.5 0.9134
AT3G52890 KIPK KCBP-interacting protein kinas... Lus10006273 3.9 0.9056
AT1G72180 Leucine-rich receptor-like pro... Lus10009476 9.6 0.9081
Lus10031697 13.0 0.8281
AT2G38120 MAP1, WAV5, PIR... WAVY ROOTS 5, MODIFIER OF ARF7... Lus10004831 13.0 0.8888
AT1G07230 NPC1 non-specific phospholipase C1 ... Lus10040678 15.0 0.8729
AT1G43650 nodulin MtN21 /EamA-like trans... Lus10028585 16.1 0.8706
AT4G28640 AUX_IAA IAA11 indole-3-acetic acid inducible... Lus10024958 16.4 0.9046
AT2G23340 AP2_ERF DEAR3 DREB and EAR motif protein 3 (... Lus10010043 19.9 0.8389

Lus10023680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.