Lus10023689 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13580 302 / 3e-104 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G24020 301 / 6e-104 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G07730 137 / 6e-38 Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT2G39430 130 / 4e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G55230 130 / 5e-36 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT2G28670 127 / 1e-35 ESB1 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT1G65870 64 / 3e-12 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 60 / 8e-11 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G58090 59 / 3e-10 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 57 / 6e-10 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011767 432 / 2e-155 AT3G24020 339 / 7e-119 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10029585 125 / 3e-36 AT2G28670 166 / 6e-53 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10006317 127 / 6e-35 AT2G28670 271 / 1e-89 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Lus10030318 104 / 6e-27 AT3G55230 276 / 2e-93 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10003301 100 / 7e-24 AT3G55230 254 / 2e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10016231 64 / 4e-12 AT1G65870 149 / 8e-46 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 62 / 5e-11 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 58 / 3e-10 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10021084 57 / 7e-10 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G174300 337 / 6e-118 AT3G24020 315 / 2e-109 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054000 321 / 1e-111 AT3G24020 352 / 5e-124 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G054100 313 / 4e-108 AT4G13580 308 / 3e-106 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.008G049200 142 / 6e-41 AT2G28670 276 / 2e-90 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.008G049100 123 / 9e-33 AT2G39430 251 / 6e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G211800 121 / 1e-32 AT2G28670 257 / 6e-83 ENHANCED SUBERIN 1, Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.010G211900 116 / 3e-30 AT2G39430 249 / 3e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.010G212000 95 / 2e-23 AT1G07730 103 / 1e-25 Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.016G061000 62 / 1e-11 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060801 61 / 3e-11 AT1G58170 164 / 5e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10023689 pacid=23148332 polypeptide=Lus10023689 locus=Lus10023689.g ID=Lus10023689.BGIv1.0 annot-version=v1.0
ATGATATTGACCAAGGCATTGCCATCATCTATTTTCGTTTGCTTTGCATTTGCTGCAATATGCATGTCAACTTATGCAGCTGCTGTGGAACCAGCACAAG
CTGCTGAAGAGCCGGTTCTAGAGTTCTACATGCACGACATTCTCGGTGGAAGTAGCCCAACAGCGAGGCCGATCACAGGCTTGCTAGGAAACATCTACAG
CGGGCAGGTTCCCTTTGCTAGGCCAGTTGGGTTCGTCCCACCAAAAGGCGGAGTAGCCATCCCTAATGCCAATGGTGCCATCCCAACTGTTAATGTTAAT
GGCATTCCTTTAGGAACTGGCTTGGCTGGAACCACTTATGCTGGAGGACAAGCCACTTCTGGCAACCAAAACAATCAGATCCAGACCCAGCTGGGTCCCG
ACGGATTGGGACTTGGGTTCGGAACCATAACTGCCATTGATGATATTCTCACTTCCACCCCTGAGTTGGGATCACAGCAACTGGGGAAAGCTCAGGGTGT
CTACGTAGCAAGCTCTGCTGATGGGAGCACCCAGATGATGTCGTTTACTGCCATGTTCGAAGGAGGGGAATTTGGTGATAGCCTTAACTTCTTTGGAGTG
TACAAGATAGGGAGCCCCGTATCATATCTGTCGGTGGCCGGTGGAACTGGTAAGTTTAAGCATGCCTTTGGAAGTGCCAATGTGAGAGGGCTCATCCCTT
CTGGCCAACATGTCACAGATGGTGCTGAGACATTGCTGAGGATCACTGTTCATCTTAAGTACTGA
AA sequence
>Lus10023689 pacid=23148332 polypeptide=Lus10023689 locus=Lus10023689.g ID=Lus10023689.BGIv1.0 annot-version=v1.0
MILTKALPSSIFVCFAFAAICMSTYAAAVEPAQAAEEPVLEFYMHDILGGSSPTARPITGLLGNIYSGQVPFARPVGFVPPKGGVAIPNANGAIPTVNVN
GIPLGTGLAGTTYAGGQATSGNQNNQIQTQLGPDGLGLGFGTITAIDDILTSTPELGSQQLGKAQGVYVASSADGSTQMMSFTAMFEGGEFGDSLNFFGV
YKIGSPVSYLSVAGGTGKFKHAFGSANVRGLIPSGQHVTDGAETLLRITVHLKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G24020 Disease resistance-responsive ... Lus10023689 0 1
AT3G24020 Disease resistance-responsive ... Lus10011767 1.0 0.9962
AT3G11550 CASP2 Casparian strip membrane domai... Lus10029409 1.4 0.9768
AT3G53990 Adenine nucleotide alpha hydro... Lus10022602 2.2 0.9576
AT5G57620 MYB ATMYB36 myb domain protein 36 (.1) Lus10006978 2.4 0.9595
AT1G71740 unknown protein Lus10042773 2.6 0.9506
AT2G36100 CASP1 Casparian strip membrane domai... Lus10021332 2.8 0.9582
AT3G10910 RING/U-box superfamily protein... Lus10025146 5.1 0.9278
AT2G21100 Disease resistance-responsive ... Lus10025064 5.2 0.9439
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10000318 5.7 0.9224
AT4G30200 VEL1, VIL2 VIN3-Like 2, vernalization5/VI... Lus10038260 5.7 0.9374

Lus10023689 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.