Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13520 50 / 2e-10 SMAP1 small acidic protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004400 [exp] 83 / 3e-23 AT4G13520 52 / 5e-11 small acidic protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G174000 [exp] 66 / 2e-16 AT4G13520 54 / 2e-11 small acidic protein 1 (.1) Potri.010G063100 [exp] 66 / 3e-16 AT4G13520 51 / 2e-10 small acidic protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023702 pacid=23148251 polypeptide=Lus10023702 locus=Lus10023702.g ID=Lus10023702.BGIv1.0 annot-version=v1.0 ATGAGGCCGATGCAGATGGATTTCTTTGCGGACATGGAGGAGCAAGGGTCGACGGTGGCGATGGACGTCGACGACGTGGATCCGCTCGAGATCTTCAACG AAGGCATGATGAACGATAGCAAGCTCGTCGACGCCGATTTCTTCAACAAGTTCGAGGATGATTTCGATGACTCCGACATCAACTAA
AA sequence Show only first row Show all	>Lus10023702 pacid=23148251 polypeptide=Lus10023702 locus=Lus10023702.g ID=Lus10023702.BGIv1.0 annot-version=v1.0 MRPMQMDFFADMEEQGSTVAMDVDDVDPLEIFNEGMMNDSKLVDADFFNKFEDDFDDSDIN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10023702 [exp]	0	1
AT2G27020		PAG1	20S proteasome alpha subunit G...		Lus10041296 [exp]	1.4	0.8595
AT3G17120			unknown protein		Lus10010906 [exp]	1.7	0.8150
AT1G21720		PBC1	proteasome beta subunit C1 (.1...		Lus10004885 [exp]	2.4	0.8530
AT3G03100			NADH:ubiquinone oxidoreductase...		Lus10007886 [exp]	2.8	0.7951
AT2G02510			NADH dehydrogenase (ubiquinone...		Lus10005182 [exp]	4.7	0.7741
AT2G31490			unknown protein		Lus10027603 [exp]	5.5	0.7940
AT5G45190			Cyclin family protein (.1.2)		Lus10040640 [exp]	6.2	0.7689
AT1G31817		NFD3	NUCLEAR FUSION DEFECTIVE 3, Ri...		Lus10012155 [exp]	6.5	0.7926
AT4G09550		ATGIP1	ARABIDOPSIS ATGCP3 INTERACTING...		Lus10040621 [exp]	6.7	0.7858
AT1G16000			unknown protein		Lus10011478 [exp]	6.9	0.7924

Compare expression of checked genes

Lus10023702 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.