Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT2G03720 68 / 3e-15 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03290 66 / 1e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G17390 65 / 2e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G69080 60 / 8e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G44760 56 / 2e-10 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014459 [exp] 254 / 8e-88 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10032598 [exp] 225 / 2e-76 AT4G13450 177 / 7e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10043152 [exp] 223 / 3e-75 AT4G13450 178 / 4e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034661 [exp] 61 / 3e-12 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10019173 [exp] 59 / 2e-11 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10029664 [exp] 52 / 5e-09 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10036814 [exp] 50 / 7e-09 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10007982 [exp] 52 / 1e-08 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10042701 [exp] 51 / 1e-08 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G064800 [exp] 152 / 1e-47 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.010G140200 [exp] 61 / 3e-12 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.008G109000 [exp] 61 / 5e-12 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.T170801 [exp] 61 / 5e-12 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.015G060700 [exp] 61 / 6e-12 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G084600 [exp] 52 / 5e-09 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G177100 [exp] 52 / 7e-09 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023716 pacid=23148327 polypeptide=Lus10023716 locus=Lus10023716.g ID=Lus10023716.BGIv1.0 annot-version=v1.0 ATGGCTGAAGGGGAGGTTGATTTCTTGGAAGCAATGAAGCAGCTTTGTGAGGTGGCTAGGCCGAGGGTGAGGGTGAAGGTTGAGAGGGTGCAGATGGGAG CTAAAGACAAGGCAAGCGTCATCCTTTTCAAGAGCACCTCCATGGCTGTTGATCATCTCATCATTGGCCAGAAGAAGAGCCTCTCCAGTGTCTTGTTAGG GAACACCAAATACAAGAAACCAGGAGGGTTAGGGCCAAAGTCGTTGGACACTGCAGAGTATTTGATCGAGTACAGCAAGTGTAATTGTGTTGGAGTCCAG AAAAAGGGGCAAACTGGAGGTTATCTTCTCAATACAAAGACCCAGAAGAATTTCTGGCTTCTCGCTTAA
AA sequence Show only first row Show all	>Lus10023716 pacid=23148327 polypeptide=Lus10023716 locus=Lus10023716.g ID=Lus10023716.BGIv1.0 annot-version=v1.0 MAEGEVDFLEAMKQLCEVARPRVRVKVERVQMGAKDKASVILFKSTSMAVDHLIIGQKKSLSSVLLGNTKYKKPGGLGPKSLDTAEYLIEYSKCNCVGVQ KKGQTGGYLLNTKTQKNFWLLA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G13450			Adenine nucleotide alpha hydro...		Lus10023716 [exp]	0	1
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10028397 [exp]	1.0	0.9339
AT4G17030		ATHEXPBETA3.1, ...	expansin-like B1 (.1)		Lus10001010 [exp]	3.2	0.9142
AT3G51070			S-adenosyl-L-methionine-depend...		Lus10028354 [exp]	3.9	0.9111
					Lus10025020 [exp]	4.8	0.8405
AT5G02390		DAU1	DUO1-activated unknown 1, Prot...		Lus10016715 [exp]	5.3	0.9110
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10028201 [exp]	6.7	0.8964
AT4G13450			Adenine nucleotide alpha hydro...		Lus10014459 [exp]	6.9	0.8687
AT3G28580			P-loop containing nucleoside t...		Lus10014497 [exp]	7.0	0.8891
AT5G08560			transducin family protein / WD...		Lus10001412 [exp]	9.2	0.8442
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10041851 [exp]	9.2	0.8537

Compare expression of checked genes

Lus10023716 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.