Lus10023734 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G05620 194 / 4e-65 PGR5 proton gradient regulation 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011777 246 / 1e-85 AT2G05620 194 / 2e-65 proton gradient regulation 5 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G066900 185 / 1e-61 AT2G05620 173 / 7e-57 proton gradient regulation 5 (.1)
Potri.008G171000 176 / 5e-58 AT2G05620 179 / 2e-59 proton gradient regulation 5 (.1)
PFAM info
Representative CDS sequence
>Lus10023734 pacid=23148329 polypeptide=Lus10023734 locus=Lus10023734.g ID=Lus10023734.BGIv1.0 annot-version=v1.0
ATGGCTGTTGCTTCCATTTCTGCAACTGGGTTGAAAGGAGGTTTAAGTTCTTCTTCATTCATCGGGGGATGGGGCACTTGTCTAGGTGGAGAAGAATATC
GGTCGTTGGCCAAGTCACATCCACCACAAGAAGTCAGAATTCTGAGGAGAGCCAAGATGCTACCTCCCATGATGAAGAACGTTAATGAAGGCAAGGGTCT
CTTTGCTCCTGCTGTTGTTGTTGCTCGCAATCTTATTGGCAAGAAGAGGTTCAATCAGCTTCGTGGCAAAGCTATCGCCTTGCACTCACAGGTGATTACT
GAGTTCTGCAAGTCGATAGGAGCAGACGCGAAGCAAAGGCAGGGGCTGATCAGGCTTGCCAAGAAGAATGGAGAGAAACTTGGATTCCTTGCTTGA
AA sequence
>Lus10023734 pacid=23148329 polypeptide=Lus10023734 locus=Lus10023734.g ID=Lus10023734.BGIv1.0 annot-version=v1.0
MAVASISATGLKGGLSSSSFIGGWGTCLGGEEYRSLAKSHPPQEVRILRRAKMLPPMMKNVNEGKGLFAPAVVVARNLIGKKRFNQLRGKAIALHSQVIT
EFCKSIGADAKQRQGLIRLAKKNGEKLGFLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G05620 PGR5 proton gradient regulation 5 (... Lus10023734 0 1
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014694 1.4 0.9352
AT1G74640 alpha/beta-Hydrolases superfam... Lus10024219 3.2 0.9328
AT4G37200 HCF164 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10022477 4.6 0.9282
AT5G40500 unknown protein Lus10002519 6.5 0.9005
AT5G19940 Plastid-lipid associated prote... Lus10026221 7.7 0.9260
AT3G54890 LHCA1 photosystem I light harvesting... Lus10023509 8.1 0.9206
AT3G54890 LHCA1 photosystem I light harvesting... Lus10040391 8.4 0.9194
AT1G61520 LHCA3*1, LHCA3*... photosystem I light harvesting... Lus10016074 8.9 0.9215
AT1G77090 Mog1/PsbP/DUF1795-like photosy... Lus10028633 9.8 0.9175
AT2G23840 HNH endonuclease (.1) Lus10010678 12.5 0.8971

Lus10023734 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.