Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011779 [exp] 131 / 4e-39 AT1G32120 69 / 9e-13 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G067000 [exp] 82 / 3e-20 AT5G13890 50 / 9e-07 Family of unknown function (DUF716) (.1), Family of unknown function (DUF716) (.2), Family of unknown function (DUF716) (.3) Potri.008G170900 [exp] 80 / 2e-19 AT5G13890 50 / 7e-07 Family of unknown function (DUF716) (.1), Family of unknown function (DUF716) (.2), Family of unknown function (DUF716) (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023736 pacid=23148292 polypeptide=Lus10023736 locus=Lus10023736.g ID=Lus10023736.BGIv1.0 annot-version=v1.0 ATGATTGTGCTTTCTCCAAGAGATGGGAATGCTGAGCTCAAGTGTGATCTTGATCAGGATGCCTTCAGGGGTGAGGCATTGGCGAGTTTGTTGTTTGCTG GCCATTCCATTTTGGTCTTGCTTCTGAGTTTTGGGGTTTTCGGGTTGTTGTCAAGTAATAAGAAGTTCAGGTATGGTGAAACTAGTGGCCCATTGCTAGC GGCTCTAGATTCAGAGAATCGTTTGGTGCGGACGATTGCAGACAGTGAGTTTGAATGA
AA sequence Show only first row Show all	>Lus10023736 pacid=23148292 polypeptide=Lus10023736 locus=Lus10023736.g ID=Lus10023736.BGIv1.0 annot-version=v1.0 MIVLSPRDGNAELKCDLDQDAFRGEALASLLFAGHSILVLLLSFGVFGLLSSNKKFRYGETSGPLLAALDSENRLVRTIADSEFE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023736 [exp]	0	1
AT5G50990			Tetratricopeptide repeat (TPR)...		Lus10000230 [exp]	76.4	0.6021
AT4G37770		ACS8	1-amino-cyclopropane-1-carboxy...		Lus10039647 [exp]	80.7	0.5995
AT3G46790		CRR2	CHLORORESPIRATORY REDUCTION 2,...		Lus10001557 [exp]	136.1	0.5558
AT3G21740		APO4	ACCUMULATION OF PHOTOSYSTEM ON...		Lus10027182 [exp]	176.1	0.5381
AT5G11090			serine-rich protein-related (....		Lus10038101 [exp]	185.5	0.5165

Compare expression of checked genes

Lus10023736 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.