Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G33390 54 / 6e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011781 [exp] 111 / 1e-33 AT2G33390 76 / 1e-19 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G067200 [exp] 67 / 3e-16 AT2G33390 76 / 3e-19 unknown protein Potri.008G170700 [exp] 66 / 1e-15 AT2G33390 77 / 8e-20 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023738 pacid=23148394 polypeptide=Lus10023738 locus=Lus10023738.g ID=Lus10023738.BGIv1.0 annot-version=v1.0 ATGGGTGAAGATGATAAGGAGGCTAATGGATGCAATACCAAGCCTTTGATATGTAAAGATAGCGAGGAAGTGGAGAATCAAGTGGATGATTGTGAGGAGG AGGAGGAGGAGGAGGAGGGGGAAGAGAGCGAGTCTAAGTCCTTGTTGGCTCCGAGGAAAGGTGGGATGTCGAAAAAGTCGCCCAAAGCTGGGAGGAAAGT TCAGTGGAATGACAACAATGGGCATAAGCTTGTCGAGATTCTGGAGTTTGAACCCAGGTAA
AA sequence Show only first row Show all	>Lus10023738 pacid=23148394 polypeptide=Lus10023738 locus=Lus10023738.g ID=Lus10023738.BGIv1.0 annot-version=v1.0 MGEDDKEANGCNTKPLICKDSEEVENQVDDCEEEEEEEEGEESESKSLLAPRKGGMSKKSPKAGRKVQWNDNNGHKLVEILEFEPR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33390			unknown protein		Lus10023738 [exp]	0	1
AT4G09810			Nucleotide-sugar transporter f...		Lus10020837 [exp]	2.0	0.8389
AT2G33390			unknown protein		Lus10011781 [exp]	2.4	0.8362
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10012109 [exp]	3.5	0.8175
AT3G30380			alpha/beta-Hydrolases superfam...		Lus10036842 [exp]	6.4	0.8513
AT5G39785			Protein of unknown function (D...		Lus10015368 [exp]	22.1	0.7705
AT5G39865			Glutaredoxin family protein (....		Lus10001669 [exp]	22.8	0.7865
AT1G78080	AP2_ERF	CAF1, RAP2.4, W...	wound induced dedifferentiatio...		Lus10022497 [exp]	27.8	0.7639
AT3G15470			Transducin/WD40 repeat-like su...		Lus10027670 [exp]	29.6	0.7385
AT5G20120			unknown protein		Lus10043283 [exp]	32.6	0.7496
AT2G04220			Plant protein of unknown funct...		Lus10013755 [exp]	32.6	0.6928

Compare expression of checked genes

Lus10023738 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.