Lus10023745 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22310 206 / 1e-70 Uncharacterised protein family (UPF0041) (.1)
AT4G14695 192 / 3e-65 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2)
AT4G05590 187 / 5e-63 unknown protein
AT5G20090 79 / 2e-20 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2), Uncharacterised protein family (UPF0041) (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011790 221 / 1e-76 AT4G22310 202 / 3e-69 Uncharacterised protein family (UPF0041) (.1)
Lus10032564 164 / 5e-54 AT4G22310 163 / 5e-54 Uncharacterised protein family (UPF0041) (.1)
Lus10025851 73 / 5e-18 AT5G20090 190 / 2e-64 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2), Uncharacterised protein family (UPF0041) (.3)
Lus10038250 73 / 5e-18 AT5G20090 190 / 2e-64 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2), Uncharacterised protein family (UPF0041) (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G023100 199 / 3e-68 AT4G22310 205 / 3e-70 Uncharacterised protein family (UPF0041) (.1)
Potri.001G333902 77 / 1e-19 AT5G20090 144 / 5e-46 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2), Uncharacterised protein family (UPF0041) (.3)
Potri.012G095133 68 / 4e-16 AT5G20090 199 / 5e-68 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2), Uncharacterised protein family (UPF0041) (.3)
Potri.015G092500 67 / 1e-15 AT5G20090 189 / 7e-64 Uncharacterised protein family (UPF0041) (.1), Uncharacterised protein family (UPF0041) (.2), Uncharacterised protein family (UPF0041) (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0141 MtN3-like PF03650 MPC Mitochondrial pyruvate carriers
Representative CDS sequence
>Lus10023745 pacid=23148370 polypeptide=Lus10023745 locus=Lus10023745.g ID=Lus10023745.BGIv1.0 annot-version=v1.0
ATGGCGACTTCCAAGCTACAAGCTCTATGGAATCACCCTGCTGGTCCTAAAACCATCCACTTTTGGGCTCCAACGTTCAAATGGGGCATCAGCATTGCAA
ATGTTGCAGATTTTGCGAAACCTCCTGAGAAGATTTCTTATCCTCAGCAGATAGCTGTGACATGTACTGGAATCATCTGGTCCCGCTACAGCACCGTGAT
AACGCCGAAAAACTGGAATCTGTTTAGCGTAAATGTCGCAATGGCTGCAACAGGGATCTATCAGCTGTCCCGTAAATTACGGCATGACTACTCTTCTGAG
AAAGAGCCTGCACTTGCCGAAGAATAA
AA sequence
>Lus10023745 pacid=23148370 polypeptide=Lus10023745 locus=Lus10023745.g ID=Lus10023745.BGIv1.0 annot-version=v1.0
MATSKLQALWNHPAGPKTIHFWAPTFKWGISIANVADFAKPPEKISYPQQIAVTCTGIIWSRYSTVITPKNWNLFSVNVAMAATGIYQLSRKLRHDYSSE
KEPALAEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22310 Uncharacterised protein family... Lus10023745 0 1
AT3G22290 Endoplasmic reticulum vesicle ... Lus10023828 1.0 0.9714
AT4G17960 unknown protein Lus10000314 1.4 0.9666
AT1G56700 Peptidase C15, pyroglutamyl pe... Lus10001521 2.2 0.9596
AT5G11950 LOG8 LONELY GUY 8, Putative lysine ... Lus10026131 2.4 0.9574
AT1G62040 ATG8C autophagy 8c, Ubiquitin-like s... Lus10015563 3.9 0.9651
AT4G32180 ATPANK2 pantothenate kinase 2 (.1.2.3) Lus10013019 5.3 0.9604
AT1G11905 B-cell receptor-associated pro... Lus10000048 5.5 0.9554
AT1G55160 unknown protein Lus10019322 5.8 0.9399
AT5G64370 PYD3, BETA-UP PYRIMIDINE 3, beta-ureidopropi... Lus10020436 8.1 0.9548
AT2G29410 ATMTPB1, MTPB1 metal tolerance protein B1 (.1... Lus10016487 8.1 0.9473

Lus10023745 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.