Lus10023747 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G33450 180 / 4e-59 Ribosomal L28 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011792 275 / 5e-95 AT2G33450 178 / 1e-56 Ribosomal L28 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G068500 192 / 7e-64 AT2G33450 202 / 8e-68 Ribosomal L28 family (.1)
Potri.008G169800 184 / 1e-60 AT2G33450 194 / 1e-64 Ribosomal L28 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00830 Ribosomal_L28 Ribosomal L28 family
Representative CDS sequence
>Lus10023747 pacid=23148355 polypeptide=Lus10023747 locus=Lus10023747.g ID=Lus10023747.BGIv1.0 annot-version=v1.0
ATGGCGTCAGCGACAGCGGGCATGTTACTGGGGAACAACCTGAGTCTCCGCGTTCCAAGAACCAATCTTCGGTTCTCAACTCTGCATTCTTCTTCAAAGG
CCTCCGCCATTTCGGAACTAGGATTCCTCGGTTATCAATTGAGTGGCATCCGAATCTCCGACCACCTCAATTCGGCCAGACCCATCTCGGCTCCATTCAG
GCCGGCTCTCCAGCCCATCGTCGCCAGGAGGGTGTGTCCGTTTACAGGGAAGAAATCGAACAGGGCGAACAAGGTGTCCTTCTCAAACCACAAGACGAAG
AAGCTTCAGTGCGTCAACTTGCAGTATAAGAAGCTTTGGTGGGAAGGAGGGAAGCGCTTCCTCAAGCTCCGTTTATCCACTAAAGCTTTGAAGACCATCG
AGAAGAATGGGATCGATGCCGTCGCTAAGAAGGCCGGTATTGATCTTAGCAAGATGTAA
AA sequence
>Lus10023747 pacid=23148355 polypeptide=Lus10023747 locus=Lus10023747.g ID=Lus10023747.BGIv1.0 annot-version=v1.0
MASATAGMLLGNNLSLRVPRTNLRFSTLHSSSKASAISELGFLGYQLSGIRISDHLNSARPISAPFRPALQPIVARRVCPFTGKKSNRANKVSFSNHKTK
KLQCVNLQYKKLWWEGGKRFLKLRLSTKALKTIEKNGIDAVAKKAGIDLSKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G33450 Ribosomal L28 family (.1) Lus10023747 0 1
AT5G11450 PPD5 PsbP domain protein 5, Mog1/Ps... Lus10022110 2.4 0.9757
AT5G65220 Ribosomal L29 family protein ... Lus10000745 3.2 0.9752
AT2G33450 Ribosomal L28 family (.1) Lus10011792 3.5 0.9704
AT2G30695 unknown protein Lus10008364 5.9 0.9703
AT1G05190 EMB2394 embryo defective 2394, Ribosom... Lus10029120 6.7 0.9729
AT1G07080 Thioredoxin superfamily protei... Lus10012503 7.9 0.9559
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Lus10037822 8.1 0.9697
AT4G21445 unknown protein Lus10002594 8.5 0.9637
AT5G14320 EMB3137 EMBRYO DEFECTIVE 3137, Ribosom... Lus10025642 8.8 0.9691
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10030091 10.2 0.9661

Lus10023747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.