Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023751 pacid=23151465 polypeptide=Lus10023751 locus=Lus10023751.g ID=Lus10023751.BGIv1.0 annot-version=v1.0 ATGCAAGCCCCCATCTACAGATCTAAAGTTTATTTCGCTTATATTACTTTCTCTGGCTTTTTTCTATTTCTTGTGTTGGGTACTGGCGAGGGAAAACAGG GGGATCCCACCGTCAGAAGAGTGGCCACCAGCCGAAGAGGTGATGGACAGAGAGATGGGGAGTTGGGTGTAAGAAAACAGACACAAATCCGACTTACTCG AAAAAGTCAGAAAAAGAGTGAAGAAGAGAGAAGACAGCCTTTGGGGAGGTAA
AA sequence Show only first row Show all	>Lus10023751 pacid=23151465 polypeptide=Lus10023751 locus=Lus10023751.g ID=Lus10023751.BGIv1.0 annot-version=v1.0 MQAPIYRSKVYFAYITFSGFFLFLVLGTGEGKQGDPTVRRVATSRRGDGQRDGELGVRKQTQIRLTRKSQKKSEEERRQPLGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023751 [exp]	0	1
AT2G03430			Ankyrin repeat family protein ...		Lus10036968 [exp]	1.0	0.8356
AT2G43770			Transducin/WD40 repeat-like su...		Lus10003390 [exp]	3.0	0.7605
					Lus10004560 [exp]	5.3	0.7475
AT1G17010			2-oxoglutarate (2OG) and Fe(II...		Lus10030941 [exp]	22.8	0.7660
					Lus10001901 [exp]	25.3	0.7351
AT5G07990		CYP75B1, D501, ...	TRANSPARENT TESTA 7, CYTOCHROM...		Lus10017742 [exp]	26.0	0.7460
AT5G03770		AtKdtA, KDTA	KDO transferase A (.1)		Lus10017662 [exp]	32.7	0.6803
AT4G20190			unknown protein		Lus10036246 [exp]	36.2	0.6377
AT5G38200			Class I glutamine amidotransfe...		Lus10016700 [exp]	36.7	0.7767
AT1G11000		ATMLO4, MLO4	MILDEW RESISTANCE LOCUS O 4, S...		Lus10001292 [exp]	43.0	0.6543

Compare expression of checked genes

Lus10023751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.