Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59910 186 / 1e-61 HTB4 Histone superfamily protein (.1) AT2G28720 186 / 1e-61 Histone superfamily protein (.1) AT1G07790 184 / 4e-61 HTB1 Histone superfamily protein (.1) AT5G02570 183 / 6e-61 Histone superfamily protein (.1) AT3G53650 182 / 2e-60 Histone superfamily protein (.1) AT3G45980 181 / 6e-60 H2B, HTB9 HISTONE H2B, Histone superfamily protein (.1) AT3G46030 180 / 1e-59 HTB11 Histone superfamily protein (.1) AT2G37470 179 / 3e-59 Histone superfamily protein (.1) AT5G22880 179 / 3e-59 HTB2, H2B HISTONE H2B, histone B2 (.1) AT3G09480 166 / 2e-54 Histone superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040855 [exp] 186 / 8e-62 AT3G45980 247 / 2e-85 HISTONE H2B, Histone superfamily protein (.1) Lus10005897 [exp] 186 / 1e-61 AT3G45980 244 / 1e-84 HISTONE H2B, Histone superfamily protein (.1) Lus10005893 [exp] 185 / 1e-61 AT3G45980 234 / 8e-81 HISTONE H2B, Histone superfamily protein (.1) Lus10017456 [exp] 185 / 1e-61 AT2G28720 226 / 1e-77 Histone superfamily protein (.1) Lus10037371 [exp] 183 / 1e-60 AT3G45980 233 / 3e-80 HISTONE H2B, Histone superfamily protein (.1) Lus10041347 [exp] 182 / 1e-60 AT3G45980 226 / 3e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10016156 [exp] 182 / 1e-60 AT3G45980 231 / 1e-79 HISTONE H2B, Histone superfamily protein (.1) Lus10013544 [exp] 182 / 2e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1) Lus10017292 [exp] 182 / 2e-60 AT3G45980 226 / 2e-77 HISTONE H2B, Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G030500 [exp] 187 / 2e-62 AT5G59910 190 / 4e-63 Histone superfamily protein (.1) Potri.010G230701 [exp] 187 / 3e-62 AT5G59910 191 / 3e-63 Histone superfamily protein (.1) Potri.008G030400 [exp] 187 / 3e-62 AT5G59910 191 / 2e-63 Histone superfamily protein (.1) Potri.010G231300 [exp] 186 / 8e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.008G029900 [exp] 186 / 9e-62 AT1G07790 177 / 3e-58 Histone superfamily protein (.1) Potri.004G091200 [exp] 186 / 9e-62 AT5G02570 188 / 2e-62 Histone superfamily protein (.1) Potri.008G030600 [exp] 185 / 9e-62 AT5G59910 188 / 2e-62 Histone superfamily protein (.1) Potri.010G230600 [exp] 185 / 1e-61 AT1G07790 205 / 3e-69 Histone superfamily protein (.1) Potri.010G230801 [exp] 185 / 1e-61 AT1G07790 205 / 2e-69 Histone superfamily protein (.1) Potri.009G028001 [exp] 185 / 1e-61 AT5G02570 188 / 2e-62 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10023753 pacid=23151451 polypeptide=Lus10023753 locus=Lus10023753.g ID=Lus10023753.BGIv1.0 annot-version=v1.0 ATGGCTCCCAAGGCAGAGAAGAAGCCCGCGGCGGAGAAGCAACCGACGATGGAGAAGAAGATAAGCAAGGATGGCGGTGCCGACAAGAAGAAAAAGAAGG CGAAGAAGAGCATCGAGACATACAAGATCTACATCTTCAAGGTGTTGAAGCAGGTGCATCCGGACATCGGGATCTCAAGCAAGGCCATGGGCATCATGAA CAGCTTCATCAACGATATCTTTGAGAAGCTCGCACAGGAGGCTTCCCGTTTGGCTCGTTACAACAAGAAGCCGACGATCACGTCCCGCGAGATCCAGACA GCCGTCCGATTGGTCCTCCCCGGTGAACTAGCAAAGCACGCTGTATCCGAAGGCACCAAGGCCGTCACCAAATTCACCAGCTCCTAA
AA sequence Show only first row Show all	>Lus10023753 pacid=23151451 polypeptide=Lus10023753 locus=Lus10023753.g ID=Lus10023753.BGIv1.0 annot-version=v1.0 MAPKAEKKPAAEKQPTMEKKISKDGGADKKKKKAKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREIQT AVRLVLPGELAKHAVSEGTKAVTKFTSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37470			Histone superfamily protein (....		Lus10023753 [exp]	0	1
AT3G21690			MATE efflux family protein (.1...		Lus10027169 [exp]	2.0	0.9291
AT5G66870	AS2	LBD36, ASL1	LATERAL ORGAN BOUNDARIES DOMAI...		Lus10022463 [exp]	3.0	0.9340
AT5G28470			Major facilitator superfamily ...		Lus10042182 [exp]	4.6	0.9059
AT1G02360			Chitinase family protein (.1)		Lus10038026 [exp]	4.7	0.9047
AT4G01630		ATEXP17, ATHEXP...	EXPANSIN 17, expansin A17 (.1)		Lus10038013 [exp]	6.5	0.9093
AT1G73160			UDP-Glycosyltransferase superf...		Lus10014499 [exp]	10.9	0.8965
AT1G65300	MADS	AGL38, PHE2	PHERES2, AGAMOUS-like 38 (.1)		Lus10022325 [exp]	11.9	0.9200
AT4G17550		AtG3Pp4	glycerol-3-phosphate permease ...		Lus10004358 [exp]	12.5	0.8782
AT2G35060		KUP11	K+ uptake permease 11, K+ upta...		Lus10038361 [exp]	14.0	0.9096
AT3G48990			AMP-dependent synthetase and l...		Lus10039232 [exp]	14.1	0.8836

Compare expression of checked genes

Lus10023753 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.