Lus10023782 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G02120 121 / 6e-37 PDE335, OHP PIGMENT DEFECTIVE 335, one helix protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003965 202 / 9e-69 AT5G02120 122 / 2e-37 PIGMENT DEFECTIVE 335, one helix protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G088200 144 / 1e-45 AT5G02120 119 / 7e-36 PIGMENT DEFECTIVE 335, one helix protein (.1)
PFAM info
Representative CDS sequence
>Lus10023782 pacid=23151462 polypeptide=Lus10023782 locus=Lus10023782.g ID=Lus10023782.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCCATTTCATCTCCATCCCTTCTCCCCACTAAAGCTCTCACCTGCAACCGCTCAAGTCGCCAGCTCATGCTTCCTCCTTTCAACTGTCAGA
GAACCACAACCTTACAGAAGCAACTCTCTTTCAGAGTCCAAGCTGCCAGGCTCCCTGCTGGTGTGGAGTTGCCAAAAGTTGAGCCGAAATTCAAAGCCCC
ATTCCTTGGATTCACCAGGACTGCTGAAATATGGAATTCCCGTGCTTGCATGATTGGCCTCATTGGAACTTTCTTTGTCGAATTGATAATAAACAAAGGC
ATACTTCAAGTGATTGGAGTTGAAATTGGGAAGGGACTGGATCTTCCTCTCTGA
AA sequence
>Lus10023782 pacid=23151462 polypeptide=Lus10023782 locus=Lus10023782.g ID=Lus10023782.BGIv1.0 annot-version=v1.0
MASSISSPSLLPTKALTCNRSSRQLMLPPFNCQRTTTLQKQLSFRVQAARLPAGVELPKVEPKFKAPFLGFTRTAEIWNSRACMIGLIGTFFVELIINKG
ILQVIGVEIGKGLDLPL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G02120 PDE335, OHP PIGMENT DEFECTIVE 335, one hel... Lus10023782 0 1
AT4G12830 alpha/beta-Hydrolases superfam... Lus10008747 5.0 0.9476
AT1G79040 PSBR photosystem II subunit R (.1) Lus10042461 7.1 0.9359
AT5G02120 PDE335, OHP PIGMENT DEFECTIVE 335, one hel... Lus10003965 9.2 0.9308
AT1G55670 PSAG photosystem I subunit G (.1) Lus10017476 9.2 0.9338
AT1G52590 Putative thiol-disulphide oxid... Lus10036091 10.7 0.9066
AT1G15140 FAD/NAD(P)-binding oxidoreduct... Lus10007955 11.6 0.8493
AT3G48420 Haloacid dehalogenase-like hyd... Lus10013663 12.0 0.9345
AT4G27700 Rhodanese/Cell cycle control p... Lus10008866 13.4 0.9176
AT4G28660 PSB28 photosystem II reaction center... Lus10024959 14.2 0.8993
AT4G22890 PGR5-LIKEA, PGR... PGR5-LIKE A (.1.2.3.4.5) Lus10014135 14.7 0.9263

Lus10023782 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.