Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026705 [exp] 124 / 2e-36 ND 45 / 5e-05 Lus10025495 [exp] 106 / 6e-30 AT1G54380 50 / 1e-06 spliceosome protein-related (.1) Lus10011880 [exp] 47 / 1e-07 AT1G54380 281 / 3e-90 spliceosome protein-related (.1) Lus10022813 [exp] 47 / 1e-07 AT1G54380 283 / 2e-91 spliceosome protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G124150 [exp] 51 / 4e-09 AT1G54380 253 / 2e-75 spliceosome protein-related (.1) Potri.017G036200 [exp] 44 / 7e-07 AT1G54380 264 / 2e-79 spliceosome protein-related (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023803 pacid=23151445 polypeptide=Lus10023803 locus=Lus10023803.g ID=Lus10023803.BGIv1.0 annot-version=v1.0 ATGCCAAGATTGAGGGAGGGCGAAGGCTCTCGTCCTGAAGCTGAAGCTGGAAATGGTGCGGTGATCAAGAAGTACTCGAGGGAAGAGATGGAAGGTCTGA GGTTTGTGAACGGTGGGGAGCAGCGTCAGATCTGTACGAGTGTGTACAGTGGATTAGGAGCTCGTATTGCGGAGGAGTATGAGAGTTTGGCTTCTTGCTG TGATAGCTAG
AA sequence Show only first row Show all	>Lus10023803 pacid=23151445 polypeptide=Lus10023803 locus=Lus10023803.g ID=Lus10023803.BGIv1.0 annot-version=v1.0 MPRLREGEGSRPEAEAGNGAVIKKYSREEMEGLRFVNGGEQRQICTSVYSGLGARIAEEYESLASCCDS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10023803 [exp]	0	1
AT4G04350		EMB2369	EMBRYO DEFECTIVE 2369, tRNA sy...		Lus10020041 [exp]	1.0	0.9602
AT4G02970		AT7SL-1	7SL RNA1 (.1)		Lus10018370 [exp]	6.2	0.8534
AT1G23770			F-box family protein (.1)		Lus10011411 [exp]	6.2	0.8532
					Lus10039496 [exp]	6.5	0.9386
AT3G28540			P-loop containing nucleoside t...		Lus10007270 [exp]	7.3	0.9350
AT5G05340			Peroxidase superfamily protein...		Lus10030149 [exp]	9.6	0.9234
AT1G53200			unknown protein		Lus10005971 [exp]	10.1	0.8951
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Lus10004841 [exp]	11.5	0.9109
AT3G50210			2-oxoglutarate (2OG) and Fe(II...		Lus10041597 [exp]	11.5	0.8502
					Lus10018837 [exp]	11.6	0.9234

Compare expression of checked genes

Lus10023803 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.