Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27740 75 / 1e-15 RFC3, EMB251, EMB161, EMB2775 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) AT1G21690 56 / 5e-09 RFC4, EMB1968 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA) AT1G63160 55 / 9e-09 EMB2811, RFC2 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) AT1G77470 55 / 1e-08 EMB2810, RFC5, RFC3 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019391 [exp] 82 / 7e-18 AT5G27740 643 / 0.0 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10041764 [exp] 64 / 1e-11 AT5G27740 269 / 3e-84 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10028316 [exp] 63 / 3e-11 AT5G27740 271 / 6e-86 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10043248 [exp] 61 / 1e-10 AT5G27740 561 / 0.0 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Lus10024504 [exp] 57 / 2e-09 AT1G63160 615 / 0.0 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) Lus10008003 [exp] 57 / 2e-09 AT1G63160 605 / 0.0 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) Lus10028543 [exp] 57 / 3e-09 AT1G21690 563 / 0.0 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G093400 [exp] 99 / 9e-24 AT5G27740 182 / 2e-53 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.019G040000 [exp] 77 / 2e-16 AT5G27740 621 / 0.0 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.003G123200 [exp] 62 / 5e-11 AT1G63160 587 / 0.0 EMBRYO DEFECTIVE 2811, replication factor C 2 (.1) Potri.005G120901 [exp] 60 / 5e-10 AT5G27740 240 / 8e-72 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.007G022900 [exp] 58 / 1e-09 AT5G27740 261 / 2e-82 replication factor C 3, EMBRYO DEFECTIVE 2775, EMBRYO DEFECTIVE 251, EMBRYO DEFECTIVE 161, ATPase family associated with various cellular activities (AAA) (.1) Potri.005G181300 [exp] 57 / 2e-09 AT1G21690 551 / 0.0 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA) Potri.002G080100 [exp] 40 / 0.0007 AT1G21690 505 / 1e-180 replication factor C 4, embryo defective 1968, ATPase family associated with various cellular activities (AAA)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF05496 [flax] [poplar] RuvB_N Holliday junction DNA helicase RuvB P-loop domain
Representative CDS sequence Show only first row Show all	>Lus10023810 pacid=23151478 polypeptide=Lus10023810 locus=Lus10023810.g ID=Lus10023810.BGIv1.0 annot-version=v1.0 ATGAAAGAATGGCGGCGTCGCCTCTCTTTCTCCTCCAAGCTCGAGAGTATCACCGTGGTTGATACTACTAGTAATATTACTAACAATATTGAAGGATTGG TGGTTGTTGATGATGACGGGGAGGATGATAATTATGAGATTAACAGCAATGATGATGATTTTGTTGCTGCTGCTGCTGCTGATAAATTAGTAGGGAAGCC TTTGAAGGAGAGAATTATTACTCATGATGACGACACTGATATTGATCATGAGCAGCATCTATTAGTACAGTCTTCGTTGTCGTTGTCGTCGTCGTTGGTA GAAAAGGAATTTGAATGGGCAAACAAGTACAGGCCTAAGGCTCTCAAGGATTTCATCTGCAATCGTGATAAGGCCCTTCACCTTCAATCTATTATAAAGG AAGTGAATTGTAACCACTTTATATTACAAGGACCAGCCGGGGTAGGGAAGACAACCATGATATGGGCTGTGCTCCAAGAAGCCTTTGGACCTGACAATGT TGAGAGCAAAGAAGAAGGAATGACATTCAAGCTTCAGGGGGAATCAATAGGGAGCATAAGAGTTAGAGTGAAGGCGTCGAGGCGACATGTGGAAGTGAAC GTATCTGACATGAAAGGCTATGAAAAACACATCATGGTCGAACTTATCAAGAACTCTCATCAAAGGGCTTCCTCACAGTCCTCTCATTCTTCCCCTCATT CCAAACATGATGCATGTCGAGGTAACCGGCTCTTCAGGCTTCACCTTTAG
AA sequence Show only first row Show all	>Lus10023810 pacid=23151478 polypeptide=Lus10023810 locus=Lus10023810.g ID=Lus10023810.BGIv1.0 annot-version=v1.0 MKEWRRRLSFSSKLESITVVDTTSNITNNIEGLVVVDDDGEDDNYEINSNDDDFVAAAAADKLVGKPLKERIITHDDDTDIDHEQHLLVQSSLSLSSSLV EKEFEWANKYRPKALKDFICNRDKALHLQSIIKEVNCNHFILQGPAGVGKTTMIWAVLQEAFGPDNVESKEEGMTFKLQGESIGSIRVRVKASRRHVEVN VSDMKGYEKHIMVELIKNSHQRASSQSSHSSPHSKHDACRGNRLFRLHL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G27740		RFC3, EMB251, E...	replication factor C 3, EMBRYO...		Lus10023810 [exp]	0	1
AT5G09970		CYP78A7	"cytochrome P450, family 78, s...		Lus10006821 [exp]	2.0	0.8718
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10024728 [exp]	2.8	0.8263
AT1G64660		ATMGL	methionine gamma-lyase (.1)		Lus10000880 [exp]	3.5	0.8186
AT1G55790			Domain of unknown function (DU...		Lus10032899 [exp]	8.4	0.7188
					Lus10040545 [exp]	9.5	0.7517
AT5G01300			PEBP (phosphatidylethanolamine...		Lus10003388 [exp]	10.5	0.7561
AT1G70890		MLP43	MLP-like protein 43 (.1)		Lus10012467 [exp]	12.2	0.8174
					Lus10023004 [exp]	13.7	0.6740
AT5G08450			unknown protein		Lus10004298 [exp]	15.2	0.7036
AT5G43080		CYCA3;1	Cyclin A3;1 (.1)		Lus10026598 [exp]	15.5	0.6788

Compare expression of checked genes

Lus10023810 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.