Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15910 120 / 2e-37 CSL zinc finger domain-containing protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021009 [exp] 132 / 6e-42 AT2G15910 125 / 3e-39 CSL zinc finger domain-containing protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G109100 [exp] 121 / 8e-38 AT2G15910 137 / 5e-44 CSL zinc finger domain-containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF05207 [flax] [poplar] zf-CSL CSL zinc finger
Representative CDS sequence Show only first row Show all	>Lus10023841 pacid=23160660 polypeptide=Lus10023841 locus=Lus10023841.g ID=Lus10023841.BGIv1.0 annot-version=v1.0 ATGTCGTACGACGACGTGGAGATAGAAGACATGGAGTGGAACGAGGACCTACAATCGTACACGTACCCGTGCCCGTGTGGCGATCTGTTCCAGATAACAA AGGAGGATCTCCGGATCGGAGAGGAGATCGCTCGGTGTCCGAGCTGCTCCCTCTACATCACCGTCATATACAACCCAGAAGACTTCGACGAGTCGAAGGG GAAGAAGAAGAAGAAGAGCGGCGGGAATAGCATCCAGCAGCAACAGCAGACGATCTCTGTTGCTTGA
AA sequence Show only first row Show all	>Lus10023841 pacid=23160660 polypeptide=Lus10023841 locus=Lus10023841.g ID=Lus10023841.BGIv1.0 annot-version=v1.0 MSYDDVEIEDMEWNEDLQSYTYPCPCGDLFQITKEDLRIGEEIARCPSCSLYITVIYNPEDFDESKGKKKKKSGGNSIQQQQQTISVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15910			CSL zinc finger domain-contain...		Lus10023841 [exp]	0	1
AT5G55640			unknown protein		Lus10043162 [exp]	1.4	0.8317
AT1G02370			Tetratricopeptide repeat (TPR)...		Lus10021053 [exp]	3.6	0.8372
AT4G16450			unknown protein		Lus10038803 [exp]	4.5	0.8146
AT4G18372			Small nuclear ribonucleoprotei...		Lus10000241 [exp]	4.6	0.7862
AT4G01200			Calcium-dependent lipid-bindin...		Lus10008731 [exp]	5.5	0.8209
AT1G78190			Trm112p-like protein (.1)		Lus10017505 [exp]	6.7	0.7775
AT5G62730			Major facilitator superfamily ...		Lus10033101 [exp]	10.7	0.7357
					Lus10008962 [exp]	12.2	0.7359
AT5G40370		GRXC2	glutaredoxin C2, Glutaredoxin ...		Lus10013089 [exp]	13.6	0.7831
AT1G55890			Tetratricopeptide repeat (TPR)...		Lus10020073 [exp]	15.9	0.8182

Compare expression of checked genes

Lus10023841 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.