Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 225 / 3e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 216 / 8e-70 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT3G55970 141 / 2e-40 ATJRG21 jasmonate-regulated gene 21 (.1) AT5G05600 135 / 4e-38 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G17020 133 / 1e-37 ATSRG1, SRG1 senescence-related gene 1 (.1) AT1G78550 130 / 2e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 129 / 3e-36 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G21200 124 / 2e-34 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) AT3G11180 125 / 3e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G25310 124 / 5e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021002 [exp] 387 / 4e-137 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10020999 [exp] 225 / 3e-73 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10023851 [exp] 221 / 2e-71 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10004245 [exp] 197 / 2e-63 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) Lus10006759 [exp] 130 / 1e-36 AT4G21200 419 / 2e-147 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10030995 [exp] 129 / 1e-35 AT1G17020 339 / 2e-115 senescence-related gene 1 (.1) Lus10030567 [exp] 127 / 1e-35 AT4G21200 370 / 2e-128 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Lus10027807 [exp] 126 / 2e-35 AT5G05600 330 / 1e-112 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10040112 [exp] 127 / 3e-35 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G146000 [exp] 300 / 2e-102 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 293 / 9e-100 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107600 [exp] 234 / 8e-77 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.009G107550 [exp] 231 / 9e-76 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.006G101200 [exp] 134 / 6e-38 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.016G117100 [exp] 134 / 7e-38 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.004G022800 [exp] 133 / 9e-38 AT4G21200 441 / 7e-156 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.008G069300 [exp] 133 / 1e-37 AT5G05600 528 / 0.0 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.011G026700 [exp] 131 / 5e-37 AT4G21200 444 / 1e-157 ARABIDOPSIS THALIANA GIBBERELLIN 2-OXIDASE 8, gibberellin 2-oxidase 8 (.1.2.3) Potri.005G223000 [exp] 128 / 1e-35 AT4G10500 238 / 3e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10023850 pacid=23160761 polypeptide=Lus10023850 locus=Lus10023850.g ID=Lus10023850.BGIv1.0 annot-version=v1.0 ATGTATAACAGGGAAGCATGCGAGGAGTATGCAAAAGAAGTGGAGAAGCAAGCCTACAAGGTGATGGAGCTGAAACCAGACAGACTCCACGGATTCTTCA ACGACCAATCGACCAGCTTCGTGAGGCTGAATCACTACCCTCCTTGCCCAGTTCCTCACTTGGCCCTCGGAGTCGGCCGGCACAAGGACGCCGGAGCCCT CACCGTTCTTGCTCAGGACGACGTCGGCGGGCTTGAAGTGAAGAGGAAGTCCGATGGGGAGTGGGCCTGGGTCCAGCCCACTCCAGATGCTTACATTGTC AATGTTGGTGACATCATCCAGGTTTGGAGCAATGAGGCATACGAGAGCGTGGAGCACAGAGTGATGGTGAACTCAGAGAGGGAAAGGTTCTCGATTCCGT TCTTCTTCAACCCATCCCATTACACTGTGGTTCAGCCATTGGAGGAGCTACTGGTGGTGGATGCTAGTAAGAAGAAGAACATGACTACTGCAAAGTACAG GCCTTACAACTGGGGGAAGTTCTTTGTTACCAGGAAAGGCAGCAACTTCAAGAAGTTTGCTGTTGAAAACATCCAGATCTCTCACTTCAGAGTCGTTTCA GAAATCTGA
AA sequence Show only first row Show all	>Lus10023850 pacid=23160761 polypeptide=Lus10023850 locus=Lus10023850.g ID=Lus10023850.BGIv1.0 annot-version=v1.0 MYNREACEEYAKEVEKQAYKVMELKPDRLHGFFNDQSTSFVRLNHYPPCPVPHLALGVGRHKDAGALTVLAQDDVGGLEVKRKSDGEWAWVQPTPDAYIV NVGDIIQVWSNEAYESVEHRVMVNSERERFSIPFFFNPSHYTVVQPLEELLVVDASKKKNMTTAKYRPYNWGKFFVTRKGSNFKKFAVENIQISHFRVVS EI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Lus10023850 [exp]	0	1
AT3G60330		AHA7	H\(+\)-ATPase 7, H\(+\)-ATPase...		Lus10042905 [exp]	1.0	0.9716
AT5G13150		ATEXO70C1	exocyst subunit exo70 family p...		Lus10037048 [exp]	2.4	0.9529
AT2G37640		ATHEXPALPHA1.9,...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10002638 [exp]	2.4	0.9449
					Lus10018313 [exp]	4.0	0.9291
AT2G39530			Uncharacterised protein family...		Lus10031303 [exp]	4.9	0.9382
AT2G31730	bHLH		basic helix-loop-helix (bHLH) ...		Lus10041649 [exp]	5.3	0.9427
					Lus10031873 [exp]	5.5	0.9419
AT1G09850		XBCP3	xylem bark cysteine peptidase ...		Lus10024295 [exp]	6.5	0.9019
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10009480 [exp]	7.1	0.9250
					Lus10033601 [exp]	7.4	0.9222

Compare expression of checked genes

Lus10023850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.