Lus10023851 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G19010 455 / 2e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
AT4G10500 208 / 2e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G16330 208 / 2e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT3G21420 208 / 2e-64 LBO1 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G10490 207 / 3e-64 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G11180 203 / 5e-62 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT5G05600 199 / 6e-61 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G24530 195 / 2e-59 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G55290 191 / 6e-58 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020999 660 / 0 AT3G19000 473 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10021002 417 / 4e-146 AT3G19000 389 / 3e-135 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10004245 303 / 2e-102 AT3G19010 277 / 2e-92 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3)
Lus10023850 243 / 3e-80 AT3G19000 225 / 4e-73 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10042155 227 / 2e-73 AT3G19000 219 / 1e-71 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10006518 211 / 2e-65 AT3G21420 523 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10005037 206 / 3e-63 AT3G11180 471 / 3e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10004808 204 / 7e-63 AT5G05600 457 / 5e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10037292 203 / 5e-62 AT4G16330 416 / 5e-145 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G107600 528 / 0 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.009G107550 524 / 0 AT3G19000 452 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G146000 429 / 7e-151 AT3G19000 357 / 3e-122 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.004G146100 421 / 2e-147 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.010G023600 213 / 3e-66 AT3G21420 511 / 0.0 LATERAL BRANCHING OXIDOREDUCTASE 1, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.001G451900 209 / 1e-64 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.011G150100 208 / 1e-64 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.014G106700 204 / 7e-63 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.006G101200 202 / 6e-62 AT5G05600 474 / 3e-168 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.016G117100 200 / 2e-61 AT5G05600 491 / 4e-175 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10023851 pacid=23160705 polypeptide=Lus10023851 locus=Lus10023851.g ID=Lus10023851.BGIv1.0 annot-version=v1.0
ATGGTGGAAATCGATCCATCTTTCATCCAAGAAGCTGATCACAGACCACACCCAAACCACACAGAAGCGAAATCGACTGCAAATGAAATCCCAGTAGTCG
ACCTCTCTTCTCCAGCCGAATCCCTAGTTTCTCAGATTGGGGACGCCTGTGAGAAATGGGGATTCTTTCAGGTGATCAACCATGGAGTCCCGCTGGAGCT
GGTGCGCAGCATGAAGAAAGTTGGGAAAGAGTTCTTCGACTTGGCCATGGAAGAGAAGAAGAAAGTGAAGAGGGATGAAGTTCATCCCATGGGGTATCAC
GACAGCGAGCACACCAAGAACGTTCGGGACTGGAAGGAAGTCTTCGATTTCTTGGTGGTTGATCCGACTTTCGTTCCAGCTACTGAAGTTGCTGAGGATT
TGGAGCTCAGAGAATTGACTAATCAGTGGCCTCAGATGCCTGCTGATTTCAGGGAGGTGTGCGAGGAATACAACAGAGAAGTTGAAAAGCTAGCATTCAA
GCTTCTTGAACTGATTTCCCTGAGCTTGGGCGTGCCTGCTGATAAACTGAGCAGCTACTTCAAGGACCAAATCAGCTTTTCAAGGTTCAACCACTACCCG
CCATGTCCAGCTCCGGAGCTAGCTCTCGGAGTTGGAAGGCACAAGGACGGCGGTGCCTTAACCGTGCTAGCTCAAGACGACGTAGGAGGGCTGGAAATCC
GCGAGAGAAGATCCGGGGAATGGATCCCTGTCAAGCCTGTTGCTGATGCATTCATCATCAACATTGGCAACTGTATGCAGGTGTGGAGCAATGACAAGTA
CTGGAGTGCAGAGCATAGAGTTGTGGTGAACTCCAAAAGGGAAAGGTTTTCAATACCATTCTTCTTCTTCCCTTCACACTATATCCAGATCAAGCCTATG
GATGAGCTAGTGAATGATGAAAACCCTCCCAAGTACAAGGAGTTCAACTGGGGGAAGTTCTTCACTTCCCGAAACCGCAGCGACTTCGCGAAGCGCGAGG
TCGAGAACATCCAAATCGACCATTTCAAGGTGTCAGACTGA
AA sequence
>Lus10023851 pacid=23160705 polypeptide=Lus10023851 locus=Lus10023851.g ID=Lus10023851.BGIv1.0 annot-version=v1.0
MVEIDPSFIQEADHRPHPNHTEAKSTANEIPVVDLSSPAESLVSQIGDACEKWGFFQVINHGVPLELVRSMKKVGKEFFDLAMEEKKKVKRDEVHPMGYH
DSEHTKNVRDWKEVFDFLVVDPTFVPATEVAEDLELRELTNQWPQMPADFREVCEEYNREVEKLAFKLLELISLSLGVPADKLSSYFKDQISFSRFNHYP
PCPAPELALGVGRHKDGGALTVLAQDDVGGLEIRERRSGEWIPVKPVADAFIINIGNCMQVWSNDKYWSAEHRVVVNSKRERFSIPFFFFPSHYIQIKPM
DELVNDENPPKYKEFNWGKFFTSRNRSDFAKREVENIQIDHFKVSD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19000 2-oxoglutarate (2OG) and Fe(II... Lus10023851 0 1
AT2G19830 VPS32, SNF7.2 SNF7 family protein (.1) Lus10032705 1.7 0.9398
AT1G21780 BTB/POZ domain-containing prot... Lus10029677 2.0 0.9265
AT5G01830 ARM repeat superfamily protein... Lus10025244 3.5 0.8937
AT3G08890 Protein of unknown function, D... Lus10012232 3.5 0.9196
AT4G26470 Calcium-binding EF-hand family... Lus10008357 4.9 0.8825
AT1G04760 ATVAMP726 vesicle-associated membrane pr... Lus10022804 5.5 0.8933
AT5G63910 FCLY farnesylcysteine lyase (.1) Lus10010948 6.3 0.8829
AT2G02960 RING/FYVE/PHD zinc finger supe... Lus10036754 8.2 0.8725
AT2G19830 VPS32, SNF7.2 SNF7 family protein (.1) Lus10012921 8.8 0.8883
AT3G56190 ASNAP, ALPHA-SN... alpha-soluble NSF attachment p... Lus10002410 8.9 0.8635

Lus10023851 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.