Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26520 49 / 2e-08 unknown protein AT3G57500 39 / 9e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020993 [exp] 75 / 8e-19 AT2G26520 67 / 2e-15 unknown protein Lus10021765 [exp] 55 / 1e-10 AT2G26520 79 / 7e-20 unknown protein Lus10032762 [exp] 54 / 2e-10 AT2G26520 81 / 3e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G035400 [exp] 57 / 8e-12 AT2G26520 86 / 3e-22 unknown protein Potri.009G106300 [exp] 50 / 4e-09 AT2G26520 77 / 4e-19 unknown protein Potri.004G144400 [exp] 50 / 6e-09 AT2G26520 81 / 3e-20 unknown protein Potri.006G052500 [exp] 37 / 0.0004 AT3G57500 68 / 7e-16 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023859 pacid=23160766 polypeptide=Lus10023859 locus=Lus10023859.g ID=Lus10023859.BGIv1.0 annot-version=v1.0 ATGGCCTCGGTTGGAGCTGCGATAGCGGCGGTGGCGGTCGTAACGGTGTTGGGAGGAATCGCTTGCGTCATCGGAAGGGTATGTTACGGCGGCCGGGTTT TGGGGTACGGCGCCGGCCGCTACGATATGGAAAGTTGGGTCGAAACTAAGTGCTCCTCTTGCGTTGACGGTCGCCTACGTCGTGCTCCGCCGCCGCCGCC GCCCCCGTTGTCGCCGGTGGCGGAAGAGGTGGCCGCGGGAGAAGAAACCCAGAAGAGTAAAGAAGAAGAAGAAGAAGGTGACGAGCAACACAAGTCTAAA GTTGGTGGTGGGGATTAA
AA sequence Show only first row Show all	>Lus10023859 pacid=23160766 polypeptide=Lus10023859 locus=Lus10023859.g ID=Lus10023859.BGIv1.0 annot-version=v1.0 MASVGAAIAAVAVVTVLGGIACVIGRVCYGGRVLGYGAGRYDMESWVETKCSSCVDGRLRRAPPPPPPPLSPVAEEVAAGEETQKSKEEEEEGDEQHKSK VGGGD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26520			unknown protein		Lus10023859 [exp]	0	1
AT3G14880			unknown protein		Lus10026217 [exp]	12.8	0.6142
AT5G66320	GATA	GATA5	GATA transcription factor 5 (....		Lus10031096 [exp]	26.6	0.5830
AT3G11110			RING/U-box superfamily protein...		Lus10009832 [exp]	45.5	0.5328
AT5G18140			Chaperone DnaJ-domain superfam...		Lus10020286 [exp]	49.7	0.5369
AT1G29220			transcriptional regulator fami...		Lus10007288 [exp]	104.5	0.4877
AT3G14250			RING/U-box superfamily protein...		Lus10026104 [exp]	212.0	0.4498

Compare expression of checked genes

Lus10023859 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.