Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09925 165 / 2e-52 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 56 / 1e-09 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G28290 50 / 2e-07 AGP31 arabinogalactan protein 31 (.1.2) AT2G33790 48 / 9e-07 ATAGP30 arabinogalactan protein 30 (.1) AT2G47530 43 / 3e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 41 / 0.0001 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 39 / 0.0005 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014394 [exp] 226 / 1e-76 AT3G09925 104 / 6e-29 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10009837 [exp] 59 / 9e-11 AT5G05500 171 / 1e-54 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10015434 [exp] 58 / 4e-10 AT1G28290 135 / 1e-39 arabinogalactan protein 31 (.1.2) Lus10040948 [exp] 56 / 6e-10 AT5G05500 176 / 9e-57 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10018131 [exp] 48 / 4e-07 AT1G29140 118 / 5e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017440 [exp] 48 / 6e-07 AT5G05500 128 / 7e-38 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 46 / 3e-06 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10007515 [exp] 45 / 5e-06 AT5G05500 127 / 3e-37 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 45 / 7e-06 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G119100 [exp] 197 / 1e-64 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 66 / 1e-13 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.008G072000 [exp] 57 / 2e-10 AT5G05500 152 / 5e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G044700 [exp] 57 / 8e-10 AT2G34700 142 / 8e-43 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G053600 [exp] 54 / 4e-09 AT2G34700 139 / 5e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 47 / 1e-06 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 42 / 0.0001 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G231250 [exp] 41 / 0.0003 ND /
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10023887 pacid=23160777 polypeptide=Lus10023887 locus=Lus10023887.g ID=Lus10023887.BGIv1.0 annot-version=v1.0 ATGGCAACTGCTACGGGTTCATTGTTTGCAGCTACGACGATCCTCGTCTTGCTTGCTGTGGCCGTGGCTCGGTTGGAGGAATCTCCCACGGGAGAGCTTA TCCACATCTCTGGTAAAGTCCTCTGTCAAGACTGCCAGAAGAGCTACGCCGATTGGGTCAACGGCGAAAGACCCATCAAAGGCAGCAAGGTATCGTTGAC GTGCATGGACGAGAGGAAGCGAGTGATCCACTACGACAGTGACACGACTGACGACAGAGGTCAGTACGAGATGGTGGTCAGCAAATACATCAACGGGAAG CTGCTCAACGAAAAGCTGTGTCAAGTGAGGCTCGTCAGCTCACCCGACTCCAACTGCAACGTTATGACCGATTTCGCAGGTGGGAAGTCGGGAGTAAAGC TCGGCCAGCCCGCATATGTCTACCGCGGCTCGACCAAGTACGAGGTCGGATCGGTCTACTTCACGCACCCGAGGTGCGAGCGTCCTGAAGTCGGCACGTT TAACAAGGGCGGTTCCGACGACGATCAGGAATACTACCGTTTCCCAGAGACCAAATACTGA
AA sequence Show only first row Show all	>Lus10023887 pacid=23160777 polypeptide=Lus10023887 locus=Lus10023887.g ID=Lus10023887.BGIv1.0 annot-version=v1.0 MATATGSLFAATTILVLLAVAVARLEESPTGELIHISGKVLCQDCQKSYADWVNGERPIKGSKVSLTCMDERKRVIHYDSDTTDDRGQYEMVVSKYINGK LLNEKLCQVRLVSSPDSNCNVMTDFAGGKSGVKLGQPAYVYRGSTKYEVGSVYFTHPRCERPEVGTFNKGGSDDDQEYYRFPETKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09925			Pollen Ole e 1 allergen and ex...		Lus10023887 [exp]	0	1
AT1G54940		PGSIP4	plant glycogenin-like starch i...		Lus10031507 [exp]	4.8	0.7333
AT1G12560		ATHEXPALPHA1.26...	expansin A7 (.1)		Lus10014137 [exp]	11.1	0.7176
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10019993 [exp]	11.1	0.7094
AT1G63450		RHS8	root hair specific 8 (.1)		Lus10000604 [exp]	15.5	0.6903
AT3G10710		RHS12	root hair specific 12 (.1)		Lus10033399 [exp]	19.6	0.6631
AT4G02270		RHS13	root hair specific 13 (.1)		Lus10013419 [exp]	21.3	0.6801
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10028896 [exp]	22.8	0.6545
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10028508 [exp]	23.4	0.7266
AT1G30870			Peroxidase superfamily protein...		Lus10001228 [exp]	24.7	0.6494
AT1G30870			Peroxidase superfamily protein...		Lus10038393 [exp]	25.7	0.6417

Compare expression of checked genes

Lus10023887 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.