Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24620 119 / 2e-34 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G19320 116 / 1e-33 Pathogenesis-related thaumatin superfamily protein (.1) AT1G20030 113 / 5e-32 Pathogenesis-related thaumatin superfamily protein (.1.2) AT4G36010 112 / 2e-31 Pathogenesis-related thaumatin superfamily protein (.1.2) AT4G36000 108 / 9e-31 Pathogenesis-related thaumatin superfamily protein (.1) AT2G17860 108 / 2e-30 Pathogenesis-related thaumatin superfamily protein (.1) AT1G73620 108 / 3e-30 Pathogenesis-related thaumatin superfamily protein (.1) AT1G75800 109 / 4e-30 Pathogenesis-related thaumatin superfamily protein (.1) AT1G18250 107 / 7e-30 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2) AT1G75050 106 / 1e-29 Pathogenesis-related thaumatin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004410 [exp] 121 / 2e-35 AT1G20030 252 / 1e-83 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10028448 [exp] 118 / 7e-34 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10041901 [exp] 117 / 1e-33 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2) Lus10031346 [exp] 110 / 1e-32 AT1G73620 189 / 3e-62 Pathogenesis-related thaumatin superfamily protein (.1) Lus10023897 [exp] 112 / 3e-32 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1) Lus10009058 [exp] 109 / 7e-31 AT1G73620 376 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1) Lus10015705 [exp] 107 / 5e-30 AT1G75030 256 / 6e-86 thaumatin-like protein 3 (.1) Lus10032726 [exp] 106 / 2e-29 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1) Lus10025055 [exp] 106 / 2e-29 AT4G38660 359 / 6e-125 Pathogenesis-related thaumatin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G222100 [exp] 125 / 3e-37 AT1G75800 283 / 2e-95 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221700 [exp] 123 / 3e-36 AT1G75800 273 / 1e-91 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221200 [exp] 123 / 3e-36 AT1G75800 254 / 2e-84 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221900 [exp] 121 / 1e-35 AT1G75800 271 / 5e-91 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221100 [exp] 120 / 3e-35 AT1G75800 277 / 2e-93 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221800 [exp] 120 / 4e-35 AT1G75800 272 / 2e-91 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G284305 [exp] 120 / 4e-35 AT1G75800 270 / 3e-90 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221500 [exp] 118 / 2e-34 AT1G75800 269 / 6e-90 Pathogenesis-related thaumatin superfamily protein (.1) Potri.005G240900 [exp] 119 / 7e-34 AT1G75800 398 / 7e-140 Pathogenesis-related thaumatin superfamily protein (.1) Potri.001G221400 [exp] 116 / 2e-33 AT1G75800 260 / 1e-86 Pathogenesis-related thaumatin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0293 [flax] [poplar] CDC PF00314 [flax] [poplar] Thaumatin Thaumatin family
Representative CDS sequence Show only first row Show all	>Lus10023896 pacid=23160749 polypeptide=Lus10023896 locus=Lus10023896.g ID=Lus10023896.BGIv1.0 annot-version=v1.0 ATGAACTGCACGACGTCGAGCTGCTCCGGCAACGTGAATGTTGTATGTCCGCCGGAGCTGGCCGTCCGAGGCGAAGAGGACGGCGTGAATAAGGTGATTG CTTGTAAGAGTGCGTGCGATGCGTTTGGCTTGCCGCAGTATTGCTGTACAGGGATATATAGTAGTCCGGCTACATGTCGGCCGACGAACTACTCGAAGAT TTTTAAAGCGCAGTGCCCGCAGGCGTATAGCTACGCTTACGATGATACCACCAGCACGTTCTCTTGCGGCGGTGGAGCTAATTACGGCATCGTTTTCTGT CCCTCGAAAGTTTGA
AA sequence Show only first row Show all	>Lus10023896 pacid=23160749 polypeptide=Lus10023896 locus=Lus10023896.g ID=Lus10023896.BGIv1.0 annot-version=v1.0 MNCTTSSCSGNVNVVCPPELAVRGEEDGVNKVIACKSACDAFGLPQYCCTGIYSSPATCRPTNYSKIFKAQCPQAYSYAYDDTTSTFSCGGGANYGIVFC PSKV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24620			Pathogenesis-related thaumatin...		Lus10023896 [exp]	0	1
AT1G08170			Histone superfamily protein (....		Lus10041351 [exp]	2.0	0.9653
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10009872 [exp]	2.8	0.9516
AT3G52790			peptidoglycan-binding LysM dom...		Lus10027407 [exp]	4.9	0.9522
AT4G33550			Bifunctional inhibitor/lipid-t...		Lus10019029 [exp]	5.5	0.9496
AT2G04305			Magnesium transporter CorA-lik...		Lus10010751 [exp]	5.8	0.9574
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10024584 [exp]	8.5	0.9322
AT1G29450			SAUR-like auxin-responsive pro...		Lus10023970 [exp]	11.1	0.8414
AT5G61350			Protein kinase superfamily pro...		Lus10000562 [exp]	11.5	0.9447
					Lus10000749 [exp]	11.8	0.9133
AT5G17820			Peroxidase superfamily protein...		Lus10013631 [exp]	12.0	0.9369

Compare expression of checked genes

Lus10023896 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.