Lus10023899 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38670 100 / 4e-26 Pathogenesis-related thaumatin superfamily protein (.1.2.3)
AT2G17860 97 / 6e-25 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75800 98 / 1e-24 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G36010 97 / 2e-24 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75040 95 / 3e-24 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT1G75050 94 / 9e-24 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G20030 90 / 6e-22 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75030 88 / 3e-21 ATLP-3 thaumatin-like protein 3 (.1)
AT4G36000 85 / 2e-20 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G38660 86 / 6e-20 Pathogenesis-related thaumatin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023898 211 / 4e-69 AT1G20030 164 / 2e-49 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10023897 116 / 2e-32 AT1G75800 271 / 8e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10004410 110 / 6e-30 AT1G20030 252 / 1e-83 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10032726 100 / 4e-26 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
Lus10028448 99 / 3e-25 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10037483 94 / 6e-23 AT1G75030 242 / 3e-79 thaumatin-like protein 3 (.1)
Lus10041901 93 / 6e-23 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10017265 91 / 7e-22 AT1G75800 390 / 2e-136 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10015705 89 / 2e-21 AT1G75030 256 / 6e-86 thaumatin-like protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G221800 115 / 5e-32 AT1G75800 272 / 2e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G284305 115 / 5e-32 AT1G75800 270 / 3e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221900 114 / 2e-31 AT1G75800 271 / 5e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221100 111 / 2e-30 AT1G75800 277 / 2e-93 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G222100 111 / 2e-30 AT1G75800 283 / 2e-95 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221700 111 / 2e-30 AT1G75800 273 / 1e-91 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221200 110 / 9e-30 AT1G75800 254 / 2e-84 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221500 109 / 1e-29 AT1G75800 269 / 6e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G221400 102 / 6e-27 AT1G75800 260 / 1e-86 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G112700 100 / 9e-26 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Lus10023899 pacid=23160803 polypeptide=Lus10023899 locus=Lus10023899.g ID=Lus10023899.BGIv1.0 annot-version=v1.0
ATGGACGGGTTTGGGGTCGAACGAATTGCGAATCCGACGACCTCGGTGAGACCACAATTTTTAAGTGCTTTACCGGGGACTGTGGTATTTTTTTCGGAGG
ATTGCACCGACTTCGAACCAAAACGACCTGTAACCTTCATGAATTTCACACTGAACGGCCCTGGCGGGGTTGACTCCTACGTTGTAAGCTACGCCGAGGG
GTTCAACCTCCCGGTCTCCATTACACCATTCGTCCAAGGAACAGGGATAAGCTTCACTCCGCCAATCGGGAATTGCAGTGTGATAAGTTGCACAAAGAGC
CTAAACAAAGTATGTCCGCCACGGCTGCGGTTGAAGAACGACAGAGAGCGCGTGCTTGGGTGCAACAGCCCGTGCGTTGCCTATAACACGATCGTGGACT
GCTGCCCGGATCCAAACCAAGTGTGCCTCCCGAGCGATGAAAGGATTCTCTTCACGCACATCTGCCCTCAGGCTCACGTCTACCCCTTTGATGTTAATGC
CACCACCTTCACTTGCCCTGCTGGCAAGGATTACTTGATCACTTTCTGTCCATGA
AA sequence
>Lus10023899 pacid=23160803 polypeptide=Lus10023899 locus=Lus10023899.g ID=Lus10023899.BGIv1.0 annot-version=v1.0
MDGFGVERIANPTTSVRPQFLSALPGTVVFFSEDCTDFEPKRPVTFMNFTLNGPGGVDSYVVSYAEGFNLPVSITPFVQGTGISFTPPIGNCSVISCTKS
LNKVCPPRLRLKNDRERVLGCNSPCVAYNTIVDCCPDPNQVCLPSDERILFTHICPQAHVYPFDVNATTFTCPAGKDYLITFCP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38670 Pathogenesis-related thaumatin... Lus10023899 0 1

Lus10023899 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.