Lus10023907 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G53180 112 / 3e-30 NodGS nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023900 128 / 1e-35 AT3G53180 1148 / 0.0 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Lus10014407 60 / 1e-11 AT3G53180 530 / 1e-175 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G121000 109 / 3e-29 AT3G53180 1176 / 0.0 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
PFAM info
Representative CDS sequence
>Lus10023907 pacid=23160737 polypeptide=Lus10023907 locus=Lus10023907.g ID=Lus10023907.BGIv1.0 annot-version=v1.0
ATGAAGCTGGTCGACTGCCACGCACACAACATCGTCTCGCTCGATTCCTCGTTTCCTTTCCTCAATGAAGCCACCAGCGACTTCGCTCCTCATTCCCTTT
CCTTCAAGGAATCAGTTGCATCTGCTTGCTTCAAAGCAGCAAGAATCTCTGCGGTGCTAGTTGACGATGGTTTGAAGTTGGACAGTATTCTGAAGATTGA
CTGGCACAGAAGTTACTTCCCGTCTGTGGGTAGAATATTAACAATTGAACGATTAGCGGAGGAAATTCTGGAACAAGTGAGATATATAGCTTCTGACATG
ATAAATTAG
AA sequence
>Lus10023907 pacid=23160737 polypeptide=Lus10023907 locus=Lus10023907.g ID=Lus10023907.BGIv1.0 annot-version=v1.0
MKLVDCHAHNIVSLDSSFPFLNEATSDFAPHSLSFKESVASACFKAARISAVLVDDGLKLDSILKIDWHRSYFPSVGRILTIERLAEEILEQVRYIASDM
IN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023907 0 1
AT1G71760 unknown protein Lus10004010 10.8 0.7956
AT4G01860 Transducin family protein / WD... Lus10038045 13.2 0.7972
AT1G72810 Pyridoxal-5'-phosphate-depende... Lus10003316 17.1 0.7297
AT2G32350 Ubiquitin-like superfamily pro... Lus10039679 24.3 0.7653
AT4G14180 ATPRD1 putative recombination initiat... Lus10021481 26.0 0.7531
AT5G16630 ATRAD4 DNA repair protein Rad4 family... Lus10000108 31.1 0.7826
AT5G53210 bHLH SPCH, bHLH098 SPEECHLESS, basic helix-loop-h... Lus10014938 36.2 0.7685
AT1G13630 Tetratricopeptide repeat (TPR)... Lus10036836 38.8 0.7631
AT4G15790 unknown protein Lus10004794 40.9 0.7624
AT4G01030 pentatricopeptide (PPR) repeat... Lus10017350 44.8 0.7334

Lus10023907 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.