Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G53180 113 / 3e-30 NodGS nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023906 [exp] 142 / 7e-45 AT3G53180 199 / 2e-60 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10014407 [exp] 150 / 4e-43 AT3G53180 530 / 1e-175 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10033799 [exp] 72 / 2e-17 AT3G53180 104 / 2e-27 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10023900 [exp] 0 / 1 AT3G53180 1148 / 0.0 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1) Lus10024005 [exp] 0 / 1 AT3G53180 247 / 3e-74 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G121000 [exp] 113 / 3e-30 AT3G53180 1176 / 0.0 nodulin/glutamine synthase-like protein, glutamate-ammonia ligases;catalytics;glutamate-ammonia ligases (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023908 pacid=23160828 polypeptide=Lus10023908 locus=Lus10023908.g ID=Lus10023908.BGIv1.0 annot-version=v1.0 ATGAACGGATCCAACCCAACACGTGGAGTGGAGCATATCAATGCTGGGGGGAAGAGAACAAGGAAGCACCACTTCGGACTGCTCGTCCTCCTGGCATCTC AAGACGGCCTAGTCAGCAATTTCGAGATCAAGTGTTTTGATGGTTGCGCCAATCCACACCTCGGCTTGGCTTCCATCCTAGCTGCCGGCAATGATGGCCT CAGGAGACATCTTAGTCTGCCGGAGCCTATTGAGACGAATCCTTCCCTCTTAGAAGGGAACCTCCAACGTTTGCCGCGGTCACTCTCCGAGTCTGTGAGA GCACTCGAAAATGATAATGTGTTAGATGACCTGATCGGTGGCAACCGATTGTGCTGCGACAAAAGCAGTTAG
AA sequence Show only first row Show all	>Lus10023908 pacid=23160828 polypeptide=Lus10023908 locus=Lus10023908.g ID=Lus10023908.BGIv1.0 annot-version=v1.0 MNGSNPTRGVEHINAGGKRTRKHHFGLLVLLASQDGLVSNFEIKCFDGCANPHLGLASILAAGNDGLRRHLSLPEPIETNPSLLEGNLQRLPRSLSESVR ALENDNVLDDLIGGNRLCCDKSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023908 [exp]	0	1
AT5G26770			unknown protein		Lus10031444 [exp]	1.0	0.9229
AT5G05670			signal recognition particle bi...		Lus10013031 [exp]	1.4	0.9128
AT5G56670			Ribosomal protein S30 family p...		Lus10028808 [exp]	2.8	0.8692
					Lus10018566 [exp]	3.2	0.8640
AT2G46910			Plastid-lipid associated prote...		Lus10010277 [exp]	3.5	0.8759
AT2G22540	MADS	AGL22, SVP	SHORT VEGETATIVE PHASE, AGAMOU...		Lus10025719 [exp]	5.9	0.8613
AT3G53180		NodGS	nodulin/glutamine synthase-lik...		Lus10023906 [exp]	9.5	0.7880
AT1G48175		TAD1, EMB2191	tRNA adenosine deaminase 1, em...		Lus10009163 [exp]	10.1	0.8635
AT5G66130		ATRAD17	RADIATION SENSITIVE 17 (.1)		Lus10028430 [exp]	10.6	0.8422
AT2G28230			TATA-binding related factor (T...		Lus10030654 [exp]	12.7	0.8583

Compare expression of checked genes

Lus10023908 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.