Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G36835 193 / 4e-65 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014416 [exp] 221 / 3e-75 AT2G36835 167 / 4e-54 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G122200 [exp] 204 / 1e-69 AT2G36835 194 / 1e-65 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10023919 pacid=23160694 polypeptide=Lus10023919 locus=Lus10023919.g ID=Lus10023919.BGIv1.0 annot-version=v1.0 ATGTCGAAGAAAGGAGGCGCTGAGTTGCAGAACGAAGCGCCATGGCGGGTCTCCACCTCCAAACCAATCCCCAAAATCCATATCTCTCCTGTTCTCCGCG TCTCTCATGACCCTTACTCCGAATACGCCATCTCTGTCATGAAGCACCATGATCCGATTGGAAGTGGAATGGCGATTGATGCGATTGTGGAAGCTGCTGG ACCCGATTGCTTAGTTCCTGGGCAAATTACTCCCGTTCGATTGCTCGGACTTAAGGTGTGGCCGATTGAAGTGGACTTGAAGTTTATGGAACCAGTTGGA CGGGAACTTAAAACGCTTGGCAGGTTCATGGACAATGCCGTCAACTTGATGAACAAATCCTTCATCGACCGTGAGTAG
AA sequence Show only first row Show all	>Lus10023919 pacid=23160694 polypeptide=Lus10023919 locus=Lus10023919.g ID=Lus10023919.BGIv1.0 annot-version=v1.0 MSKKGGAELQNEAPWRVSTSKPIPKIHISPVLRVSHDPYSEYAISVMKHHDPIGSGMAIDAIVEAAGPDCLVPGQITPVRLLGLKVWPIEVDLKFMEPVG RELKTLGRFMDNAVNLMNKSFIDRE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G36835			unknown protein		Lus10023919 [exp]	0	1
AT4G16580			Protein phosphatase 2C family ...		Lus10023916 [exp]	8.1	0.7995
AT5G14890			NHL domain-containing protein ...		Lus10032160 [exp]	19.3	0.8582
AT5G06130			chaperone protein dnaJ-related...		Lus10014223 [exp]	38.1	0.8172
AT1G67910			unknown protein		Lus10034901 [exp]	46.3	0.8134
AT5G54680	bHLH	bHLH105, ILR3	iaa-leucine resistant3, basic ...		Lus10020069 [exp]	58.5	0.8263
AT1G10150		ATPP2-A10	Carbohydrate-binding protein (...		Lus10003785 [exp]	63.7	0.7774
AT5G58950			Protein kinase superfamily pro...		Lus10011173 [exp]	72.4	0.8176
AT1G60420			DC1 domain-containing protein ...		Lus10029148 [exp]	84.4	0.7661
AT2G01410			NHL domain-containing protein ...		Lus10031240 [exp]	88.5	0.7940
AT1G57790			F-box family protein (.1)		Lus10022706 [exp]	98.7	0.8023

Compare expression of checked genes

Lus10023919 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.