Plant FIBer expression Database

Lus10023928 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36930 182 / 1e-59 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014426
[exp]
241 / 3e-84 AT2G36930 180 / 7e-59 zinc finger (C2H2 type) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G124100
[exp]
192 / 9e-65 AT2G36930 184 / 1e-60 zinc finger (C2H2 type) family protein (.1)
Potri.016G093500
[exp]
191 / 2e-64 AT2G36930 184 / 2e-60 zinc finger (C2H2 type) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Representative CDS sequence
>Lus10023928 pacid=23160690 polypeptide=Lus10023928 locus=Lus10023928.g ID=Lus10023928.BGIv1.0 annot-version=v1.0
ATGGGAGGAAAATGCCCGAGTAGGAAGGTGAAGAAGAGAAGGTTCTCTCACAAGTCAGCTCGTCGCACCAAATTCGAACTCATGGGCGATGACGCGGTCT
ACGAACAGTTGCAGAAGCCTGACGCCGATAAGAAACCGTTGCCCCTCGACGAGGATTTGCCTGGCATGGGCCAGTTTTACTGCTTGATCTGCGACCGCTA
CTTCGCTAATGTGAGTGTGAGAGATGAGCATTTCAAGACCAAGCGTCATAGGAAGCGTGTGAAGGAACTGAAAACTGCACCACACACTCAACTTGATGCC
GACTTAGCAAGTGGTATGGGTATGCCAGACAACGGCCCTACGCTCATGTCAATGTGA
AA sequence
>Lus10023928 pacid=23160690 polypeptide=Lus10023928 locus=Lus10023928.g ID=Lus10023928.BGIv1.0 annot-version=v1.0
MGGKCPSRKVKKRRFSHKSARRTKFELMGDDAVYEQLQKPDADKKPLPLDEDLPGMGQFYCLICDRYFANVSVRDEHFKTKRHRKRVKELKTAPHTQLDA
DLASGMGMPDNGPTLMSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10023928
[exp]
0 1
AT2G35900 unknown protein Lus10021249
[exp]
1.0 0.8848
AT1G02020 nitroreductase family protein ... Lus10030289
[exp]
5.7 0.8217
AT1G26800 RING/U-box superfamily protein... Lus10036757
[exp]
6.3 0.8165
AT1G76060 EMB1793 EMBRYO DEFECTIVE 1793, LYR fam... Lus10005621
[exp]
6.5 0.8383
AT5G64920 CIP8 COP1-interacting protein 8 (.1... Lus10031422
[exp]
8.8 0.8161
AT5G51740 Peptidase family M48 family pr... Lus10038897
[exp]
8.8 0.8233
AT4G18372 Small nuclear ribonucleoprotei... Lus10042823
[exp]
8.9 0.8109
AT5G41685 Mitochondrial outer membrane t... Lus10001641
[exp]
9.7 0.7791
AT2G20940 Protein of unknown function (D... Lus10034474
[exp]
10.8 0.7882
AT2G32120 HSP70T-2 heat-shock protein 70T-2 (.1.2... Lus10041207
[exp]
11.4 0.8525

Lus10023928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.