Lus10023938 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36800 164 / 1e-48 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1)
AT2G36790 157 / 4e-46 UGT73C6 UDP-glucosyl transferase 73C6 (.1)
AT2G36780 153 / 1e-44 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36770 152 / 5e-44 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36760 152 / 5e-44 UGT73C2 UDP-glucosyl transferase 73C2 (.1)
AT2G36750 148 / 9e-43 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1)
AT3G53160 122 / 8e-33 UGT73C7 UDP-glucosyl transferase 73C7 (.1)
AT3G53150 116 / 7e-31 UGT73D1 UDP-glucosyl transferase 73D1 (.1)
AT4G34131 97 / 9e-24 UGT73B3 UDP-glucosyl transferase 73B3 (.1)
AT4G34135 92 / 1e-22 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014437 311 / 2e-105 AT2G36780 545 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003323 194 / 4e-60 AT2G36800 493 / 2e-171 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1)
Lus10012011 194 / 4e-60 AT2G36780 488 / 8e-170 UDP-Glycosyltransferase superfamily protein (.1)
Lus10016268 194 / 5e-60 AT2G36780 498 / 1e-173 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003322 182 / 2e-55 AT2G36780 468 / 9e-162 UDP-Glycosyltransferase superfamily protein (.1)
Lus10023939 156 / 9e-46 AT2G36780 485 / 7e-169 UDP-Glycosyltransferase superfamily protein (.1)
Lus10023893 120 / 3e-32 AT2G36780 495 / 1e-172 UDP-Glycosyltransferase superfamily protein (.1)
Lus10022628 114 / 3e-30 AT2G36780 310 / 1e-101 UDP-Glycosyltransferase superfamily protein (.1)
Lus10014401 108 / 7e-28 AT3G53150 537 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G048700 159 / 9e-47 AT2G36800 550 / 0.0 UDP-GLUCOSYL TRANSFERASE 73C5, don-glucosyltransferase 1 (.1)
Potri.006G120600 135 / 5e-38 AT3G53150 617 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Potri.016G097400 129 / 2e-35 AT3G53150 626 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Potri.001G303000 112 / 2e-29 AT4G34131 573 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303600 112 / 3e-29 AT4G34131 568 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G303300 110 / 1e-28 AT2G15480 555 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G303700 109 / 2e-28 AT2G15480 558 / 0.0 UDP-glucosyl transferase 73B5 (.1.2)
Potri.001G302300 109 / 2e-28 AT4G34131 488 / 4e-170 UDP-glucosyl transferase 73B3 (.1)
Potri.009G098966 105 / 6e-27 AT4G34131 588 / 0.0 UDP-glucosyl transferase 73B3 (.1)
Potri.001G302400 101 / 2e-25 AT2G15490 494 / 1e-172 UDP-glycosyltransferase 73B4 (.1.2.3)
PFAM info
Representative CDS sequence
>Lus10023938 pacid=23160736 polypeptide=Lus10023938 locus=Lus10023938.g ID=Lus10023938.BGIv1.0 annot-version=v1.0
ATGGTCGACATCGCCGAACTCCTCGCCACCCCCACAAATCCTCGTTACTACGTCCACGTCACCATCGTCACAACACCTCTGAACGCAGCCTGGTTCGCCA
CCCCTCTCGCTCGAGCCAACGAAAACCTCCACATCCCCATCAACTTAGTCCAATTCCGGTTCCCCTGCACCGAAGCAGGGCTCCCCGAAAACTGGGAGAA
CTGCGACATGCTCCCTTCGTTGGAATCGATCGTCGGGATCTTCCAGGCTGCCTCGTTGATAGAACCGGATGTCGTTTTCTTATTCGAGAAGCTGGAGCCG
AGGCCCACGTGCATCATCTCCGATTTCTGCTTGCCTTACACCAACAACGTCGCGAAGAAGTTCAACGTTCCGAGGATTAGCTTCCATGGGTTTAGCTGTT
TCTGCCTCGCGTGCTTGCATTGCATTAAGCTTCACGAGGAAGAAGTAGACCGGAGAGTTGGCTCCGATTTCGACTCGTTCCTCGTTCCCGGATTCCCCGG
TGGGATCCGGTTCACCAAGGCTTAG
AA sequence
>Lus10023938 pacid=23160736 polypeptide=Lus10023938 locus=Lus10023938.g ID=Lus10023938.BGIv1.0 annot-version=v1.0
MVDIAELLATPTNPRYYVHVTIVTTPLNAAWFATPLARANENLHIPINLVQFRFPCTEAGLPENWENCDMLPSLESIVGIFQAASLIEPDVVFLFEKLEP
RPTCIISDFCLPYTNNVAKKFNVPRISFHGFSCFCLACLHCIKLHEEEVDRRVGSDFDSFLVPGFPGGIRFTKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36800 UGT73C5, DOGT1 UDP-GLUCOSYL TRANSFERASE 73C5,... Lus10023938 0 1
AT5G19730 Pectin lyase-like superfamily ... Lus10034981 3.6 0.8756
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10039501 6.0 0.8713
AT3G06060 TSC10A TSC10A, NAD(P)-binding Rossman... Lus10039502 7.3 0.8680
Lus10021453 8.7 0.8349
AT5G60590 DHBP synthase RibB-like alpha/... Lus10037409 8.8 0.7027
AT1G71050 HIPP20 heavy metal associated isopren... Lus10042946 9.8 0.8456
Lus10015218 12.5 0.8324
AT3G53180 NodGS nodulin/glutamine synthase-lik... Lus10023904 12.7 0.8296
AT2G38560 RDO2, TFIIS REDUCED DORMANCY 2, transcript... Lus10034247 13.0 0.8217
AT4G11530 CRK34 cysteine-rich RLK (RECEPTOR-li... Lus10022285 13.6 0.8296

Lus10023938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.