Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17120 138 / 6e-41 LYM2 lysm domain GPI-anchored protein 2 precursor (.1) AT1G21880 66 / 7e-14 LYM1 lysm domain GPI-anchored protein 1 precursor (.1.2) AT1G77630 58 / 5e-11 LYM3 lysin-motif \(LysM\) domain protein 3, Peptidoglycan-binding LysM domain-containing protein (.1) AT2G23770 41 / 6e-05 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014442 [exp] 223 / 1e-75 AT2G17120 223 / 2e-72 lysm domain GPI-anchored protein 2 precursor (.1) Lus10023945 [exp] 133 / 8e-39 AT2G17120 280 / 4e-92 lysm domain GPI-anchored protein 2 precursor (.1) Lus10014441 [exp] 130 / 2e-36 AT4G38380 501 / 2e-167 MATE efflux family protein (.1) Lus10026372 [exp] 107 / 5e-29 AT2G17120 249 / 3e-80 lysm domain GPI-anchored protein 2 precursor (.1) Lus10022630 [exp] 103 / 2e-27 AT2G17120 255 / 1e-82 lysm domain GPI-anchored protein 2 precursor (.1) Lus10003326 [exp] 102 / 5e-27 AT2G17120 255 / 1e-82 lysm domain GPI-anchored protein 2 precursor (.1) Lus10018191 [exp] 71 / 2e-15 AT1G21880 550 / 0.0 lysm domain GPI-anchored protein 1 precursor (.1.2) Lus10025643 [exp] 71 / 2e-15 AT1G21880 547 / 0.0 lysm domain GPI-anchored protein 1 precursor (.1.2) Lus10037389 [exp] 50 / 4e-08 AT2G33580 202 / 1e-56 Protein kinase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G143300 [exp] 145 / 1e-43 AT2G17120 311 / 1e-104 lysm domain GPI-anchored protein 2 precursor (.1) Potri.004G183500 [exp] 144 / 2e-43 AT2G17120 318 / 3e-107 lysm domain GPI-anchored protein 2 precursor (.1) Potri.005G176700 [exp] 72 / 6e-16 AT1G21880 548 / 0.0 lysm domain GPI-anchored protein 1 precursor (.1.2) Potri.002G084800 [exp] 69 / 5e-15 AT1G21880 554 / 0.0 lysm domain GPI-anchored protein 1 precursor (.1.2) Potri.015G085350 [exp] 39 / 0.0004 AT2G23770 125 / 7e-33 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.005G128300 [exp] 37 / 0.001 AT2G23770 394 / 2e-129 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1) Potri.009G010300 [exp] 37 / 0.001 AT2G23770 234 / 3e-68 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0187 [flax] [poplar] LysM PF01476 [flax] [poplar] LysM LysM domain
Representative CDS sequence Show only first row Show all	>Lus10023946 pacid=23160773 polypeptide=Lus10023946 locus=Lus10023946.g ID=Lus10023946.BGIv1.0 annot-version=v1.0 ATGTACTCGGTCCAGCCGGGAGATGGGCTTTTCGTGATCGCGTCCAGTAAGTTCATGGGCCTGGTGAAGTACGAGCAGATCGTAGCTGTTAACAATATCG CGGACCCGAATTTGATCGAGGTAGGCCAGCAGCTGTGGATCCCGCTGCCGTGTAGCTGCGAGGACGTCGACGGGGAGAGGGTGGTGCATTACACTCACGT GGTGGTCGGAGGGAGTTCCGTGGAGGAGATCGCGGCGGAGTTTGGAACGACCAACGAGACTTTGTATCGGATTAATGGGATTCAGAGTGACGCTCAGCTT ATTGAAGGCGACCCCTTTGATGTTCCTCTTAAAGCATAA
AA sequence Show only first row Show all	>Lus10023946 pacid=23160773 polypeptide=Lus10023946 locus=Lus10023946.g ID=Lus10023946.BGIv1.0 annot-version=v1.0 MYSVQPGDGLFVIASSKFMGLVKYEQIVAVNNIADPNLIEVGQQLWIPLPCSCEDVDGERVVHYTHVVVGGSSVEEIAAEFGTTNETLYRINGIQSDAQL IEGDPFDVPLKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17120		LYM2	lysm domain GPI-anchored prote...		Lus10023946 [exp]	0	1
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10002296 [exp]	1.0	0.9381
AT3G57120			Protein kinase superfamily pro...		Lus10029720 [exp]	2.0	0.9078
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021540 [exp]	4.9	0.8823
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004043 [exp]	6.7	0.8428
AT5G48540			receptor-like protein kinase-r...		Lus10038227 [exp]	8.0	0.8815
AT4G32300		SD2-5	S-domain-2 5 (.1)		Lus10034194 [exp]	9.6	0.8161
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10017693 [exp]	13.0	0.8442
AT5G24130			unknown protein		Lus10039332 [exp]	14.3	0.8359
AT2G38010			Neutral/alkaline non-lysosomal...		Lus10021122 [exp]	14.8	0.8809
AT1G11770			FAD-binding Berberine family p...		Lus10023366 [exp]	17.0	0.8623

Compare expression of checked genes

Lus10023946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.