Lus10023950 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10023950 pacid=23160811 polypeptide=Lus10023950 locus=Lus10023950.g ID=Lus10023950.BGIv1.0 annot-version=v1.0
ATGACGCAAGTCTTGGAGATGCCCATAGATGATCAGAAGGATGTTCTGTATCTGGCATCGACATTGGGAAGGGTGTCGGTGCCAATATACCTCGGCGCAG
GGTGCCAAGAAACTTTGGGACTTGGCGACTTGGGTGCTTGGCATCGTTGGATGCGAGAAACCTACAATGTTTTGAGTTTTTCCGAAAGGGATGATCAGTG
GATATGGCGACTTCAATCGATCGCAAGGGTGATTCATGAGCTGTACAGACTACAGAGTATTAACAACCTTTGGTATGAACATTCTGTTCTGTTCTTCACA
ACCATCATGTTTTACAAGACGAAAACAGAATGA
AA sequence
>Lus10023950 pacid=23160811 polypeptide=Lus10023950 locus=Lus10023950.g ID=Lus10023950.BGIv1.0 annot-version=v1.0
MTQVLEMPIDDQKDVLYLASTLGRVSVPIYLGAGCQETLGLGDLGAWHRWMRETYNVLSFSERDDQWIWRLQSIARVIHELYRLQSINNLWYEHSVLFFT
TIMFYKTKTE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10023950 0 1
AT2G36020 HVA22J HVA22-like protein J (.1) Lus10016974 17.5 0.9175
AT1G12140 FMOGS-OX5 ,FMO ... flavin-monooxygenase glucosino... Lus10032247 24.3 0.8667
Lus10015413 27.7 0.9149
AT4G35780 STY17 serine/threonine/tyrosine kina... Lus10041845 28.8 0.9087
AT2G14095 unknown protein Lus10012704 29.8 0.9095
AT3G22490 Seed maturation protein (.1) Lus10022058 32.4 0.9119
AT2G36020 HVA22J HVA22-like protein J (.1) Lus10021299 32.5 0.9115
AT1G12110 CHL1-1, CHL1, B... CHLORINA 1, ARABIDOPSIS THALIA... Lus10024614 37.7 0.9094
AT5G38710 Methylenetetrahydrofolate redu... Lus10034094 41.0 0.9037
Lus10006284 52.3 0.9049

Lus10023950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.