Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17080 51 / 2e-09 Arabidopsis protein of unknown function (DUF241) (.1) AT2G17070 49 / 8e-09 Arabidopsis protein of unknown function (DUF241) (.1) AT4G35200 47 / 4e-08 Arabidopsis protein of unknown function (DUF241) (.1) AT4G35210 46 / 1e-07 Arabidopsis protein of unknown function (DUF241) (.1) AT3G51400 44 / 6e-07 Arabidopsis protein of unknown function (DUF241) (.1) AT4G35710 44 / 9e-07 Arabidopsis protein of unknown function (DUF241) (.1) AT4G35690 37 / 0.0003 Arabidopsis protein of unknown function (DUF241) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023957 [exp] 126 / 1e-38 AT2G17080 177 / 2e-55 Arabidopsis protein of unknown function (DUF241) (.1) Lus10025126 [exp] 121 / 4e-36 AT2G17080 218 / 1e-70 Arabidopsis protein of unknown function (DUF241) (.1) Lus10014451 [exp] 87 / 3e-22 AT2G26100 437 / 1e-153 Galactosyltransferase family protein (.1) Lus10022635 [exp] 67 / 3e-15 AT4G35200 175 / 3e-54 Arabidopsis protein of unknown function (DUF241) (.1) Lus10007109 [exp] 67 / 6e-15 AT2G17070 189 / 2e-59 Arabidopsis protein of unknown function (DUF241) (.1) Lus10003332 [exp] 65 / 2e-14 AT4G35200 177 / 3e-55 Arabidopsis protein of unknown function (DUF241) (.1) Lus10014447 [exp] 63 / 1e-13 AT2G17080 205 / 2e-65 Arabidopsis protein of unknown function (DUF241) (.1) Lus10025122 [exp] 62 / 2e-13 AT4G35210 214 / 3e-69 Arabidopsis protein of unknown function (DUF241) (.1) Lus10023958 [exp] 62 / 2e-13 AT4G35200 193 / 6e-61 Arabidopsis protein of unknown function (DUF241) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G182700 [exp] 75 / 4e-18 AT2G17080 200 / 2e-63 Arabidopsis protein of unknown function (DUF241) (.1) Potri.004G182250 [exp] 73 / 3e-17 AT2G17080 191 / 1e-59 Arabidopsis protein of unknown function (DUF241) (.1) Potri.004G182550 [exp] 72 / 3e-17 AT2G17080 196 / 6e-62 Arabidopsis protein of unknown function (DUF241) (.1) Potri.004G182400 [exp] 69 / 6e-16 AT2G17070 193 / 2e-60 Arabidopsis protein of unknown function (DUF241) (.1) Potri.009G142500 [exp] 67 / 5e-15 AT2G17070 175 / 2e-53 Arabidopsis protein of unknown function (DUF241) (.1) Potri.009G142700 [exp] 66 / 1e-14 AT2G17080 204 / 9e-65 Arabidopsis protein of unknown function (DUF241) (.1) Potri.009G142400 [exp] 57 / 1e-11 AT2G17080 202 / 4e-64 Arabidopsis protein of unknown function (DUF241) (.1) Potri.009G142600 [exp] 57 / 1e-11 AT2G17080 202 / 6e-64 Arabidopsis protein of unknown function (DUF241) (.1) Potri.005G249100 [exp] 54 / 3e-10 AT2G17080 149 / 1e-43 Arabidopsis protein of unknown function (DUF241) (.1) Potri.005G248975 [exp] 45 / 2e-07 AT2G17080 164 / 2e-49 Arabidopsis protein of unknown function (DUF241) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0133 [flax] [poplar] AT14A-like PF03087 [flax] [poplar] DUF241 Arabidopsis protein of unknown function
Representative CDS sequence Show only first row Show all	>Lus10023954 pacid=23160656 polypeptide=Lus10023954 locus=Lus10023954.g ID=Lus10023954.BGIv1.0 annot-version=v1.0 ATGAATGAATTCACAACAGTGGATGCTTCACTGGAAGCTCTACTGGGAAACAAAACTAACAAATGTGACGAAGTTCAGACCCAGTTGAAGGATTTGGAGC TGTGCATTCAAGATCTCGAGCAAGGAACCGAGTGCCTCTACAGGAGGATGATCAAATCTAGAGTCGCCATTCTTAACATCTTCAACTAG
AA sequence Show only first row Show all	>Lus10023954 pacid=23160656 polypeptide=Lus10023954 locus=Lus10023954.g ID=Lus10023954.BGIv1.0 annot-version=v1.0 MNEFTTVDASLEALLGNKTNKCDEVQTQLKDLELCIQDLEQGTECLYRRMIKSRVAILNIFN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17080			Arabidopsis protein of unknown...		Lus10023954 [exp]	0	1
AT2G43870			Pectin lyase-like superfamily ...		Lus10002126 [exp]	6.1	0.8529
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10012818 [exp]	30.2	0.7449
AT1G24430			HXXXD-type acyl-transferase fa...		Lus10025729 [exp]	42.2	0.8063
AT1G10030		ERG28	homolog of yeast ergosterol28 ...		Lus10028239 [exp]	53.4	0.7476
					Lus10025086 [exp]	60.7	0.7560
AT1G75717			unknown protein		Lus10034523 [exp]	72.4	0.7488
AT1G71250			GDSL-like Lipase/Acylhydrolase...		Lus10039152 [exp]	90.3	0.6668
AT2G41560		ACA4	"autoinhibited Ca\(2+\)-ATPase...		Lus10019758 [exp]	91.7	0.7661
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Lus10036793 [exp]	103.0	0.7177
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10025797 [exp]	147.0	0.7320

Compare expression of checked genes

Lus10023954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.