Lus10023954 [FLAX]

| External link |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Symbol | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Arabidopsis homologues
|
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Paralogs
|
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Poplar homologues |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PFAM info |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
Representative CDS sequence |
>Lus10023954 pacid=23160656 polypeptide=Lus10023954 locus=Lus10023954.g ID=Lus10023954.BGIv1.0 annot-version=v1.0
ATGAATGAATTCACAACAGTGGATGCTTCACTGGAAGCTCTACTGGGAAACAAAACTAACAAATGTGACGAAGTTCAGACCCAGTTGAAGGATTTGGAGC
TGTGCATTCAAGATCTCGAGCAAGGAACCGAGTGCCTCTACAGGAGGATGATCAAATCTAGAGTCGCCATTCTTAACATCTTCAACTAG
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
AA sequence
|
>Lus10023954 pacid=23160656 polypeptide=Lus10023954 locus=Lus10023954.g ID=Lus10023954.BGIv1.0 annot-version=v1.0
MNEFTTVDASLEALLGNKTNKCDEVQTQLKDLELCIQDLEQGTECLYRRMIKSRVAILNIFN
|
DESeq2's median of ratios [FLAX]
Coexpressed genes
Lus10023954 coexpression network
*The number of genes in the network is adjusted within 50 genes.*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.