Lus10023970 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G29420 97 / 3e-26 SAUR-like auxin-responsive protein family (.1)
AT1G29450 96 / 4e-26 SAUR-like auxin-responsive protein family (.1)
AT1G29500 94 / 2e-25 SAUR-like auxin-responsive protein family (.1)
AT1G29460 91 / 9e-24 SAUR-like auxin-responsive protein family (.1)
AT5G27780 90 / 1e-23 SAUR-like auxin-responsive protein family (.1)
AT1G29490 87 / 5e-23 SAUR-like auxin-responsive protein family (.1)
AT1G29510 84 / 2e-21 SAUR68 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
AT1G29430 80 / 1e-19 SAUR-like auxin-responsive protein family (.1)
AT1G76190 78 / 5e-19 SAUR-like auxin-responsive protein family (.1)
AT1G29440 76 / 5e-18 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025114 255 / 1e-88 AT1G29450 99 / 4e-27 SAUR-like auxin-responsive protein family (.1)
Lus10023969 85 / 3e-21 AT5G27780 96 / 1e-25 SAUR-like auxin-responsive protein family (.1)
Lus10025115 73 / 8e-17 AT1G29430 88 / 6e-23 SAUR-like auxin-responsive protein family (.1)
Lus10034570 70 / 4e-16 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Lus10003337 74 / 6e-16 AT5G22800 855 / 0.0 EMBRYO DEFECTIVE 86, EMBRYO DEFECTIVE 263, EMBRYO DEFECTIVE 1030, Alanyl-tRNA synthetase, class IIc (.1)
Lus10021825 69 / 1e-15 AT1G76190 110 / 1e-32 SAUR-like auxin-responsive protein family (.1)
Lus10007060 66 / 3e-14 AT1G29430 71 / 2e-16 SAUR-like auxin-responsive protein family (.1)
Lus10034507 65 / 8e-14 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10033161 62 / 1e-12 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G140900 111 / 7e-32 AT1G29510 139 / 3e-43 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.004G181400 109 / 3e-31 AT1G29450 132 / 4e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141201 108 / 9e-31 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1)
Potri.017G043400 103 / 1e-28 AT5G27780 141 / 8e-44 SAUR-like auxin-responsive protein family (.1)
Potri.009G141150 101 / 4e-28 AT1G29450 131 / 5e-40 SAUR-like auxin-responsive protein family (.1)
Potri.009G141000 98 / 2e-26 AT1G29500 122 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Potri.017G043500 92 / 2e-24 AT5G27780 120 / 1e-35 SAUR-like auxin-responsive protein family (.1)
Potri.009G141251 88 / 5e-23 AT1G29430 93 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Potri.009G141100 88 / 8e-23 AT1G29510 117 / 8e-35 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
Potri.002G064300 84 / 3e-21 AT1G29510 109 / 2e-31 SMALL AUXIN UPREGULATED 68, SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10023970 pacid=23160675 polypeptide=Lus10023970 locus=Lus10023970.g ID=Lus10023970.BGIv1.0 annot-version=v1.0
ATGATAAACCCAAAGAAGCTAATCAAGATGGCCAAGAAGTGGCAGAGGAAGAGCATGAGCTTCAACTCCAGGACCAGCTACTCCCCCGTCGACGTCGACA
TCACCAAGTTCAATTCCTCCCCTGTCGCCAACAGGGGACACTTCGTCGTCTACACCGCCGACTTCAAGCGCTTCGTTCTCCCTCTCTCTTACCTCGAACA
CGCCGTCTTCCGGGAGCTCTTCCAGAGGTCCGAGGAAGAGTTCGGAGCTCCCGGCGACGGCCCCATCATGGTCCCCTGCGACTCTGTTTTCATGGAGAAT
TCCGTCTGGCGGATCCAGAAGTTATCGTCGTCAACGGAGGCGGAGGTTCAGGGTGGTAAGGGGAGTTTACCGGCGACGACCGCGTCGTTCTCGCCCGTGG
CCTCGTCGGTTCGAGGCGCCGGAGCTCGTGCTTTCAGATCGAGGAGTAGCTTGCTTGGTTGA
AA sequence
>Lus10023970 pacid=23160675 polypeptide=Lus10023970 locus=Lus10023970.g ID=Lus10023970.BGIv1.0 annot-version=v1.0
MINPKKLIKMAKKWQRKSMSFNSRTSYSPVDVDITKFNSSPVANRGHFVVYTADFKRFVLPLSYLEHAVFRELFQRSEEEFGAPGDGPIMVPCDSVFMEN
SVWRIQKLSSSTEAEVQGGKGSLPATTASFSPVASSVRGAGARAFRSRSSLLG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G29450 SAUR-like auxin-responsive pro... Lus10023970 0 1
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10008892 2.8 0.8131
AT5G24620 Pathogenesis-related thaumatin... Lus10023896 11.1 0.8414
AT1G08170 Histone superfamily protein (.... Lus10041351 18.4 0.8295
AT3G52790 peptidoglycan-binding LysM dom... Lus10027407 19.0 0.8299
AT4G33550 Bifunctional inhibitor/lipid-t... Lus10019029 22.1 0.8222
Lus10000749 27.0 0.7898
AT3G56850 bZIP DPBF3, AREB3 ABA-responsive element binding... Lus10028888 51.2 0.8023
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10024584 55.0 0.7730
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10007640 80.2 0.7893
AT5G08640 ATFLS1, FLS flavonol synthase 1 (.1.2) Lus10025619 83.6 0.7102

Lus10023970 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.