Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G30845 129 / 7e-40 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025102 [exp] 93 / 1e-25 AT1G30845 63 / 3e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G235800 [exp] 140 / 4e-44 AT1G30845 111 / 9e-33 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0184 [flax] [poplar] DMT PF00892 [flax] [poplar] EamA EamA-like transporter family
Representative CDS sequence Show only first row Show all	>Lus10023982 pacid=23160708 polypeptide=Lus10023982 locus=Lus10023982.g ID=Lus10023982.BGIv1.0 annot-version=v1.0 ATGGGTGTTGGCGGGAGAAAAGGAAAAGGCTACGCTTTAGCAGTGTTCGCCGGACTCAACGCAGCGTTCGCCGCCATCGCTGCTAAATTCTTCTCCAACT ACATTATCCGGTACGGGCTAGTGGTGCTGTGCAACGTTACGATGTGGGGCTGCTACGTCAACAGTCTCAAGGCGCTCTCGTCCCTACAAGCTACAGTGAC CAACTTCGCTACCAATTTCATCTCCTCTGGTCTGGCTGGCTCCTTCCTCTTCCAGGAGAGCTTGTCCGTTCAGTGGGTTGCTGGTGCGCTGCTCATTGTA ATTGGTGTGTTCATACTCAGCAAGTCAAGTGTAGAGCACAAGGAACGGACTGATTAA
AA sequence Show only first row Show all	>Lus10023982 pacid=23160708 polypeptide=Lus10023982 locus=Lus10023982.g ID=Lus10023982.BGIv1.0 annot-version=v1.0 MGVGGRKGKGYALAVFAGLNAAFAAIAAKFFSNYIIRYGLVVLCNVTMWGCYVNSLKALSSLQATVTNFATNFISSGLAGSFLFQESLSVQWVAGALLIV IGVFILSKSSVEHKERTD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G30845			unknown protein		Lus10023982 [exp]	0	1
AT5G51740			Peptidase family M48 family pr...		Lus10038897 [exp]	5.5	0.7811
AT1G20450		LTI45, ERD10, L...	LOW TEMPERATURE INDUCED 45, LO...		Lus10005652 [exp]	11.0	0.7195
AT3G22560			Acyl-CoA N-acyltransferases (N...		Lus10010569 [exp]	16.5	0.7040
AT4G21580			oxidoreductase, zinc-binding d...		Lus10018450 [exp]	17.9	0.7440
AT3G14460			LRR and NB-ARC domains-contain...		Lus10006793 [exp]	19.0	0.7373
AT4G05200		CRK25	cysteine-rich RLK (RECEPTOR-li...		Lus10015096 [exp]	20.9	0.6597
AT2G01410			NHL domain-containing protein ...		Lus10031240 [exp]	28.6	0.7500
AT5G67190	AP2_ERF	DEAR2	DREB and EAR motif protein 2 (...		Lus10009373 [exp]	36.1	0.7193
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Lus10013769 [exp]	37.5	0.7151
AT1G17070			GC-rich sequence DNA-binding f...		Lus10002251 [exp]	44.7	0.6471

Compare expression of checked genes

Lus10023982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.