Lus10023996 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025086 241 / 3e-83 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G138700 83 / 5e-21 ND /
Potri.004G178500 81 / 3e-20 ND /
PFAM info
Representative CDS sequence
>Lus10023996 pacid=23160790 polypeptide=Lus10023996 locus=Lus10023996.g ID=Lus10023996.BGIv1.0 annot-version=v1.0
ATGGACCTGAGACTCAACCATCTTGCAGCAGGCGAAAGGAAGGTTTCGTCCCCGAAACGAGAGAGGTCGATGAAAGGCAGAAGGCTGACGAGGAGTAACC
AGTTACAGCACCACCAGCAGCTGCTCGAATCGATTGCGAGAGCAAACGGTGGAGAAGGCGTTGTTAGTCATGAAGGAGGAGGAGTTGTGAGGATGAAGGT
GCTGGTGAAGAAGCAAGATTTGAAGCAGATGCTGGAGCTATTGGGAGATGGCAAGTTGCAGACCAGTAGCTTCAGGCCTACTGGAGCTGAAACCGAATTG
TCTTCATCGTCGTTCTGTAATGTGGAACAAAGATTGAATCTTTTGAGGAGGAAGCATGTGTCGAGAGGAAATGGTGGAAAGGGTTGCCGGGATTCGTCGC
CGCGGTCGTGGATTCCGGCGCTTCAAAGCATTCCGGAGTAG
AA sequence
>Lus10023996 pacid=23160790 polypeptide=Lus10023996 locus=Lus10023996.g ID=Lus10023996.BGIv1.0 annot-version=v1.0
MDLRLNHLAAGERKVSSPKRERSMKGRRLTRSNQLQHHQQLLESIARANGGEGVVSHEGGGVVRMKVLVKKQDLKQMLELLGDGKLQTSSFRPTGAETEL
SSSSFCNVEQRLNLLRRKHVSRGNGGKGCRDSSPRSWIPALQSIPE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10023996 0 1
AT5G51480 SKS2 SKU5 similar 2 (.1) Lus10038920 8.1 0.9287
Lus10025086 9.5 0.8670
AT4G31470 CAP (Cysteine-rich secretory p... Lus10011318 11.4 0.9282
AT1G06930 unknown protein Lus10024185 18.4 0.9226
AT1G53130 GRI GRIM REAPER, Stigma-specific S... Lus10005544 19.1 0.9237
AT4G10350 NAC BRN2, NST4, ANA... BEARSKIN 2, NAC domain contain... Lus10039153 24.0 0.9166
AT5G60520 Late embryogenesis abundant (L... Lus10036107 26.2 0.9161
AT4G01240 S-adenosyl-L-methionine-depend... Lus10012157 26.4 0.9179
AT4G12470 AZI1 azelaic acid induced 1 (.1) Lus10032261 31.1 0.9085
AT2G47270 bHLH bHLH151, UPB1 UPBEAT1, sequence-specific DNA... Lus10010001 31.7 0.9148

Lus10023996 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.