Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66780 40 / 3e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041741 [exp] 122 / 2e-36 AT5G66780 65 / 5e-14 unknown protein Lus10026022 [exp] 58 / 8e-12 AT5G66780 111 / 1e-32 unknown protein Lus10014313 [exp] 47 / 2e-07 AT5G66780 77 / 2e-19 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024013 pacid=23141456 polypeptide=Lus10024013 locus=Lus10024013.g ID=Lus10024013.BGIv1.0 annot-version=v1.0 ATGAATCAGGCGGCAATGAGATCTTTGAGAAGGGTGGTCTCAGGGGGTGGTAGTTTAAGGAGGAGGGTGAATACCCTCAGCAGCGATCCGGGGAGTAAGC ACAACATGGACAAAGCTGAGCAGCCTAAGGAAAACAAAGGAAACGCGATCTCGAATCAACCTGGAGATGGGTACGCGACGAGGAGCGATGAGGCTGGATT TGGCGCTGGGGAATTCGGAGGAAATGCAGAGGACAATATCAAGTTGGACCAGCAGTTCAACAAAGATCACCCTGGTTACGACAAGAGCCAGGGAAAGGAA TGGAACAAAAAGGACAAGTCTGGTAATAAGTGA
AA sequence Show only first row Show all	>Lus10024013 pacid=23141456 polypeptide=Lus10024013 locus=Lus10024013.g ID=Lus10024013.BGIv1.0 annot-version=v1.0 MNQAAMRSLRRVVSGGGSLRRRVNTLSSDPGSKHNMDKAEQPKENKGNAISNQPGDGYATRSDEAGFGAGEFGGNAEDNIKLDQQFNKDHPGYDKSQGKE WNKKDKSGNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G66780			unknown protein		Lus10024013 [exp]	0	1
AT1G68040			S-adenosyl-L-methionine-depend...		Lus10021802 [exp]	2.2	0.9112
AT2G14100		CYP705A13	"cytochrome P450, family 705, ...		Lus10024582 [exp]	3.5	0.9164
AT2G40100		LHCB4.3	light harvesting complex photo...		Lus10030403 [exp]	8.7	0.8941
					Lus10019564 [exp]	9.3	0.9248
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002774 [exp]	11.2	0.9104
					Lus10002411 [exp]	12.8	0.9242
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10031007 [exp]	14.7	0.9044
AT5G13825			unknown protein		Lus10000042 [exp]	15.9	0.9232
					Lus10034388 [exp]	23.2	0.9072
AT2G16460			Protein of unknown function (D...		Lus10041812 [exp]	27.3	0.9061

Compare expression of checked genes

Lus10024013 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.