Lus10024032 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36750 223 / 4e-74 Quinone reductase family protein (.1)
AT4G27270 180 / 2e-58 Quinone reductase family protein (.1)
AT5G54500 177 / 5e-57 FQR1 flavodoxin-like quinone reductase 1 (.1.2)
AT5G58800 157 / 2e-49 Quinone reductase family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041718 266 / 2e-91 AT4G36750 357 / 3e-125 Quinone reductase family protein (.1)
Lus10026035 239 / 8e-81 AT4G36750 371 / 4e-131 Quinone reductase family protein (.1)
Lus10014325 233 / 1e-78 AT4G36750 370 / 2e-130 Quinone reductase family protein (.1)
Lus10020076 179 / 9e-58 AT4G27270 314 / 2e-110 Quinone reductase family protein (.1)
Lus10006748 177 / 4e-57 AT4G27270 323 / 5e-114 Quinone reductase family protein (.1)
Lus10018401 170 / 2e-54 AT4G27270 342 / 3e-121 Quinone reductase family protein (.1)
Lus10007612 170 / 6e-54 AT4G27270 329 / 1e-115 Quinone reductase family protein (.1)
Lus10005862 164 / 3e-52 AT5G58800 290 / 5e-101 Quinone reductase family protein (.1.2)
Lus10040486 162 / 5e-51 AT4G36750 291 / 6e-100 Quinone reductase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G126200 225 / 2e-75 AT4G36750 361 / 4e-127 Quinone reductase family protein (.1)
Potri.007G029600 224 / 7e-75 AT4G36750 362 / 3e-127 Quinone reductase family protein (.1)
Potri.004G151100 200 / 3e-65 AT4G36750 311 / 4e-107 Quinone reductase family protein (.1)
Potri.001G410700 182 / 4e-59 AT4G27270 345 / 1e-122 Quinone reductase family protein (.1)
Potri.011G129400 177 / 3e-57 AT4G27270 342 / 2e-121 Quinone reductase family protein (.1)
Potri.011G033100 177 / 4e-57 AT4G27270 352 / 1e-125 Quinone reductase family protein (.1)
Potri.004G028900 173 / 9e-56 AT4G27270 352 / 2e-125 Quinone reductase family protein (.1)
Potri.009G044400 170 / 2e-54 AT5G58800 322 / 3e-113 Quinone reductase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0042 Flavoprotein PF03358 FMN_red NADPH-dependent FMN reductase
Representative CDS sequence
>Lus10024032 pacid=23141461 polypeptide=Lus10024032 locus=Lus10024032.g ID=Lus10024032.BGIv1.0 annot-version=v1.0
ATGTATGGCCATGTGGAGTTGTTGTCCAGGAGGATGAAGAAGGGAGTCGACGGAGTCGAAGCGGTGCTGTATCGGGTCCCGGAAACAATTCCGAACGAAT
TTTTGGAGCGGATGAAGGCGTCGCCGAAGGACCCTTCCATTCTGGAGATTACAGCGGCGGCGGAGTTGGTTGAGGCCGACGGCGTCCTGTTTGGGTTCCC
GACGAGGTACGGGTCTATGGCGGCGCAAATGAAGTCGTTTTTTGACTCCACTGGCCAATTATGGAAGGAGCAGAAAATCGCCGGGAAACCTGCTGGGTTT
TTCGTCAGCACCGGCACTCAAGGCGGCGGTCAAGAAACCACCGCATGGACAGCAATCACGCAATTGGCTCACCATGGTATGCTGTTTGTTCCTGTGGGTT
ACACATTTGGTGCTGGTATGTTCAACATGGAATCTATAAGAGGAGGATCTCCATAA
AA sequence
>Lus10024032 pacid=23141461 polypeptide=Lus10024032 locus=Lus10024032.g ID=Lus10024032.BGIv1.0 annot-version=v1.0
MYGHVELLSRRMKKGVDGVEAVLYRVPETIPNEFLERMKASPKDPSILEITAAAELVEADGVLFGFPTRYGSMAAQMKSFFDSTGQLWKEQKIAGKPAGF
FVSTGTQGGGQETTAWTAITQLAHHGMLFVPVGYTFGAGMFNMESIRGGSP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36750 Quinone reductase family prote... Lus10024032 0 1
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10013653 6.5 0.6761
AT3G15000 cobalt ion binding (.1) Lus10014696 12.5 0.7279
AT4G12560 CPR1, CPR30 CONSTITUTIVE EXPRESSER OF PR G... Lus10008871 56.3 0.5821
AT5G18200 UTP:galactose-1-phosphate urid... Lus10016535 179.0 0.5275
AT3G25210 Tetratricopeptide repeat (TPR)... Lus10038214 217.0 0.5294

Lus10024032 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.