Plant FIBer expression Database

Lus10024048 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G39880 185 / 3e-60 Ribosomal protein L23/L15e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041700
[exp]
311 / 2e-110 AT4G39880 192 / 3e-63 Ribosomal protein L23/L15e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G075500
[exp]
218 / 2e-73 AT4G39880 191 / 1e-62 Ribosomal protein L23/L15e family protein (.1)
Potri.007G093100
[exp]
112 / 2e-32 AT4G39880 90 / 1e-23 Ribosomal protein L23/L15e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00276 Ribosomal_L23 Ribosomal protein L23
Representative CDS sequence
>Lus10024048 pacid=23141601 polypeptide=Lus10024048 locus=Lus10024048.g ID=Lus10024048.BGIv1.0 annot-version=v1.0
ATGGGGAGCAGGCTAGGGAGGAAAGTGATTCACTTCGCAAACCTTCCGATCAAACTCCTAATGCCCAAGACCTACAACAACATCGACGAAATCGCCCTCA
AGACCATCCCATCCGCTTCCAAGATCGAAATCAAGCGCGTGCTCGAGTCCCTCTACGGCTTCGACGTCGACAAGGTCCGCACTCTCAACATGGAAGGCAA
GAAGAAGAAGCGCGGAGGACTTCTTTTCGCCAAGCCTGACTACAAGAAGGCCTACGTCACCCTCAAGATGCCGCTCTCCCTGTCTCCTGATTTGTTCCCG
CTCAAGGTCGTCGAGCAGGAGAAAGAGAGGATGAACAAGCAGCAGAGGTCCGGCGTCGTGGAGGACGGCGGAGATAAGAAGCACTGGCTCGAAGATAGGA
GAGGGGAGAAGGGCCGGAACGAGATCCGAGGAAGTGGAGGAGGAAGTAGCGGATACAAGGGGCGACGCGGTGATGCTGCGGCGGAGAAGCTCAAGTTCCC
TTGGAGCAGCATGAGGACTGCTAGGTAG
AA sequence
>Lus10024048 pacid=23141601 polypeptide=Lus10024048 locus=Lus10024048.g ID=Lus10024048.BGIv1.0 annot-version=v1.0
MGSRLGRKVIHFANLPIKLLMPKTYNNIDEIALKTIPSASKIEIKRVLESLYGFDVDKVRTLNMEGKKKKRGGLLFAKPDYKKAYVTLKMPLSLSPDLFP
LKVVEQEKERMNKQQRSGVVEDGGDKKHWLEDRRGEKGRNEIRGSGGGSSGYKGRRGDAAAEKLKFPWSSMRTAR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G39880 Ribosomal protein L23/L15e fam... Lus10024048
[exp]
0 1
AT3G49910 Translation protein SH3-like f... Lus10011540
[exp]
3.6 0.8768
AT3G51010 unknown protein Lus10026320
[exp]
6.5 0.8202
AT4G34880 Amidase family protein (.1) Lus10027853
[exp]
6.9 0.8362
AT1G02870 unknown protein Lus10001459
[exp]
8.7 0.8246
AT3G19120 PIF / Ping-Pong family of plan... Lus10025271
[exp]
13.9 0.8143
AT2G37270 ATRPS5B ribosomal protein 5B (.1.2) Lus10004113
[exp]
14.2 0.8284
AT5G60030 unknown protein Lus10023334
[exp]
15.2 0.8064
AT5G64670 Ribosomal protein L18e/L15 sup... Lus10032390
[exp]
23.4 0.8091
AT3G49910 Translation protein SH3-like f... Lus10028537
[exp]
25.5 0.8179
AT5G44500 Small nuclear ribonucleoprotei... Lus10038421
[exp]
25.9 0.8215

Lus10024048 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.